Endometriosis Knowledgebase

Search Result

Gene id

7533

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

YWHAH Gene UCSC Ensembl

Aliases

YWHA1

Gene name

tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta

Alternate names

14-3-3 protein eta, 14-3-3 eta, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide,

Gene location

22q12.3 (31944492: 31957602) Exons: 2 NC_000022.11

Gene summary(Entrez)

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009]

OMIM

113508

Protein Summary

Protein general information

Q04917

Name: 14 3 3 protein eta (Protein AS1)

Length: 246 Mass: 28,219

Tissue specificity: Expressed mainly in the brain and present in other tissues albeit at lower levels.

Sequence

MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGN
EKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEAS
EAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQL
LRDNLTLWTSDQQDEEAGEGN

Structural information

Interpro:	IPR000308 IPR023409 IPR023410
Prosite:	PS00796 PS00797
Pfam:	PF00244
PDB:	2C63 2C74
PDBsum:	2C63 2C74
DIP:	27566
MINT:	124456
STRING:	ENSP00000248975;

Other Databases

GeneCards: YWHAH; Malacards: YWHAH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002028	regulation of sodium ion transport	IDA	biological_process
GO:0003779	actin binding	IEA	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006713	glucocorticoid catabolic process	IDA	biological_process
GO:0006886	intracellular protein tra nsport	ISS	biological_process
GO:0014704	intercalated disc	IC	cellular_component
GO:0017080	sodium channel regulator activity	IDA	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019904	protein domain specific b inding	ISS	molecular_function
GO:0021762	substantia nigra developm ent	IEP	biological_process
GO:0030659	cytoplasmic vesicle membr ane	TAS	cellular_component
GO:0035259	glucocorticoid receptor b inding	IPI	molecular_function
GO:0042921	glucocorticoid receptor s ignaling pathway	IDA	biological_process
GO:0044325	ion channel binding	IPI	molecular_function
GO:0044325	ion channel binding	IPI	molecular_function
GO:0045664	regulation of neuron diff erentiation	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048167	regulation of synaptic pl asticity	ISS	biological_process
GO:0050774	negative regulation of de ndrite morphogenesis	ISS	biological_process
GO:0061024	membrane organization	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0086010	membrane depolarization d uring action potential	IDA	biological_process
GO:1900740	positive regulation of pr otein insertion into mito chondrial membrane involv ed in apoptotic signaling pathway	TAS	biological_process
GO:2000649	regulation of sodium ion transmembrane transporter activity	IDA	biological_process
GO:0002028	regulation of sodium ion transport	IDA	biological_process
GO:0003779	actin binding	IEA	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006713	glucocorticoid catabolic process	IDA	biological_process
GO:0006886	intracellular protein tra nsport	IEA	biological_process
GO:0006886	intracellular protein tra nsport	ISS	biological_process
GO:0014704	intercalated disc	IC	cellular_component
GO:0017080	sodium channel regulator activity	IDA	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0019904	protein domain specific b inding	ISS	molecular_function
GO:0021762	substantia nigra developm ent	IEP	biological_process
GO:0030659	cytoplasmic vesicle membr ane	TAS	cellular_component
GO:0035259	glucocorticoid receptor b inding	IPI	molecular_function
GO:0042921	glucocorticoid receptor s ignaling pathway	IDA	biological_process
GO:0044325	ion channel binding	IEA	molecular_function
GO:0044325	ion channel binding	IPI	molecular_function
GO:0044325	ion channel binding	IPI	molecular_function
GO:0045664	regulation of neuron diff erentiation	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048167	regulation of synaptic pl asticity	ISS	biological_process
GO:0050774	negative regulation of de ndrite morphogenesis	IEA	biological_process
GO:0050774	negative regulation of de ndrite morphogenesis	ISS	biological_process
GO:0061024	membrane organization	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0086010	membrane depolarization d uring action potential	IDA	biological_process
GO:1900740	positive regulation of pr otein insertion into mito chondrial membrane involv ed in apoptotic signaling pathway	TAS	biological_process
GO:2000649	regulation of sodium ion transmembrane transporter activity	IDA	biological_process
GO:0002028	regulation of sodium ion transport	IDA	biological_process
GO:0005159	insulin-like growth facto r receptor binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006713	glucocorticoid catabolic process	IDA	biological_process
GO:0006886	intracellular protein tra nsport	ISS	biological_process
GO:0014704	intercalated disc	IC	cellular_component
GO:0017080	sodium channel regulator activity	IDA	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019904	protein domain specific b inding	ISS	molecular_function
GO:0021762	substantia nigra developm ent	IEP	biological_process
GO:0030659	cytoplasmic vesicle membr ane	TAS	cellular_component
GO:0035259	glucocorticoid receptor b inding	IPI	molecular_function
GO:0042921	glucocorticoid receptor s ignaling pathway	IDA	biological_process
GO:0044325	ion channel binding	IPI	molecular_function
GO:0044325	ion channel binding	IPI	molecular_function
GO:0045664	regulation of neuron diff erentiation	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048167	regulation of synaptic pl asticity	ISS	biological_process
GO:0050774	negative regulation of de ndrite morphogenesis	ISS	biological_process
GO:0061024	membrane organization	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0086010	membrane depolarization d uring action potential	IDA	biological_process
GO:1900740	positive regulation of pr otein insertion into mito chondrial membrane involv ed in apoptotic signaling pathway	TAS	biological_process
GO:2000649	regulation of sodium ion transmembrane transporter activity	IDA	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
hsa04390  Hippo signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis

Diseases

Associated diseases	References
Endometriosis	PMID: 16210010
Endometriosis	INFBASE16210010
Parkinson's disease	PMID: 12480176
Schizophrenia	PMID: 11121172

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16210010	Endometrio sis					RON SOS 14-3-3 protein eta KSR PI3K p85and uPAR	Show abstract