Endometriosis Knowledgebase

Search Result

Gene id

7852

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CXCR4 Gene UCSC Ensembl

Aliases

CD184, D2S201E, FB22, HM89, HSY3RR, LAP-3, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM, WHIMS

Gene name

C-X-C motif chemokine receptor 4

Alternate names

C-X-C chemokine receptor type 4, CD184 antigen, LPS-associated protein 3, SDF-1 receptor, chemokine (C-X-C motif) receptor 4, chemokine receptor, fusin, leukocyte-derived seven transmembrane domain receptor, lipopolysaccharide-associated protein 3, neuropeptide Y ,

Gene location

2q22.1 (136118154: 136114348) Exons: 2 NC_000002.12

Gene summary(Entrez)

This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

OMIM

162643

Protein Summary

Protein general information

P61073

Name: C X C chemokine receptor type 4 (CXC R4) (CXCR 4) (FB22) (Fusin) (HM89) (LCR1) (Leukocyte derived seven transmembrane domain receptor) (LESTR) (Lipopolysaccharide associated protein 3) (LAP 3) (LPS associated protein 3) (NPYRL) (Stromal cell derived facto

Length: 352 Mass: 39,746

Tissue specificity: Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astro

Sequence

MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDK
YRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKL
LAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISK
LSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS

Structural information

Motifs	Important for(133-135)
Interpro:	IPR022726 IPR000355 IPR001277 IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001 PF12109
PDB:	2K03 2K04 2K05 2N55 3ODU 3OE0 3OE6 3OE8 3OE9 4RWS
PDBsum:	2K03 2K04 2K05 2N55 3ODU 3OE0 3OE6 3OE8 3OE9 4RWS
DIP:	34773 46290
MINT:	6630550
STRING:	ENSP00000386884;

Other Databases

GeneCards: CXCR4; Malacards: CXCR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001666	response to hypoxia	IEP	biological_process
GO:0001764	neuron migration	IEA	biological_process
GO:0002064	epithelial cell developme nt	IEA	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0003779	actin binding	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005770	late endosome	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0008038	neuron recognition	IEA	biological_process
GO:0008144	drug binding	IEA	molecular_function
GO:0009615	response to virus	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016494	C-X-C chemokine receptor activity	NAS	molecular_function
GO:0019064	fusion of virus membrane with host plasma membrane	TAS	biological_process
GO:0019722	calcium-mediated signalin g	IMP	biological_process
GO:0019955	cytokine binding	IEA	molecular_function
GO:0022029	telencephalon cell migrat ion	IEA	biological_process
GO:0030054	cell junction	IEA	cellular_component
GO:0030260	entry into host cell	TAS	biological_process
GO:0030334	regulation of cell migrat ion	IEA	biological_process
GO:0031252	cell leading edge	IDA	cellular_component
GO:0031410	cytoplasmic vesicle	IDA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032027	myosin light chain bindin g	IDA	molecular_function
GO:0043067	regulation of programmed cell death	IEA	biological_process
GO:0043130	ubiquitin binding	IDA	molecular_function
GO:0043217	myelin maintenance	ISS	biological_process
GO:0048714	positive regulation of ol igodendrocyte differentia tion	ISS	biological_process
GO:0050920	regulation of chemotaxis	IMP	biological_process
GO:0051924	regulation of calcium ion transport	IEA	biological_process
GO:0060048	cardiac muscle contractio n	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0071345	cellular response to cyto kine stimulus	IDA	biological_process
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001666	response to hypoxia	IEP	biological_process
GO:0001764	neuron migration	IEA	biological_process
GO:0002064	epithelial cell developme nt	IEA	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0003779	actin binding	IDA	molecular_function
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004950	chemokine receptor activi ty	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005770	late endosome	IEA	cellular_component
GO:0005770	late endosome	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0008038	neuron recognition	IEA	biological_process
GO:0008144	drug binding	IEA	molecular_function
GO:0009615	response to virus	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016477	cell migration	IEA	biological_process
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular_function
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular_function
GO:0016494	C-X-C chemokine receptor activity	NAS	molecular_function
GO:0019064	fusion of virus membrane with host plasma membrane	TAS	biological_process
GO:0019722	calcium-mediated signalin g	IMP	biological_process
GO:0019955	cytokine binding	IEA	molecular_function
GO:0022029	telencephalon cell migrat ion	IEA	biological_process
GO:0030054	cell junction	IEA	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030260	entry into host cell	TAS	biological_process
GO:0030334	regulation of cell migrat ion	IEA	biological_process
GO:0031252	cell leading edge	IDA	cellular_component
GO:0031410	cytoplasmic vesicle	IDA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032027	myosin light chain bindin g	IDA	molecular_function
GO:0043067	regulation of programmed cell death	IEA	biological_process
GO:0043130	ubiquitin binding	IEA	molecular_function
GO:0043130	ubiquitin binding	IDA	molecular_function
GO:0043217	myelin maintenance	ISS	biological_process
GO:0048714	positive regulation of ol igodendrocyte differentia tion	ISS	biological_process
GO:0050920	regulation of chemotaxis	IEA	biological_process
GO:0050920	regulation of chemotaxis	IMP	biological_process
GO:0051924	regulation of calcium ion transport	IEA	biological_process
GO:0060048	cardiac muscle contractio n	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0071345	cellular response to cyto kine stimulus	IDA	biological_process
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0001666	response to hypoxia	IEP	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0003779	actin binding	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005770	late endosome	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0009615	response to virus	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016494	C-X-C chemokine receptor activity	NAS	molecular_function
GO:0019064	fusion of virus membrane with host plasma membrane	TAS	biological_process
GO:0019722	calcium-mediated signalin g	IMP	biological_process
GO:0030260	entry into host cell	TAS	biological_process
GO:0031252	cell leading edge	IDA	cellular_component
GO:0031410	cytoplasmic vesicle	IDA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032027	myosin light chain bindin g	IDA	molecular_function
GO:0043130	ubiquitin binding	IDA	molecular_function
GO:0043217	myelin maintenance	ISS	biological_process
GO:0048714	positive regulation of ol igodendrocyte differentia tion	ISS	biological_process
GO:0050920	regulation of chemotaxis	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071345	cellular response to cyto kine stimulus	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04670  Leukocyte transendothelial migration
hsa04672  Intestinal immune network for IgA production
PTHR10489:SF594  Axon guidance mediated by Slit/Robo
PTHR10489:SF594  Axon guidance mediated by Slit/Robo

Diseases

Associated diseases	References
Asthma	PMID: 15787642
Cancer	PMID: 18636124
Celiac disease	PMID: 19240061
Coronary disease	PMID: 19336475
Diabetes	PMID: 18461161
Endometriosis	PMID: 24534089
Implantation failure	PMID: 18077318
Multiple sclerosis	PMID: 19879194
Ovarian endometriosis	PMID: 15005245
Endometriosis	INFBASE20720261
Ovarian endometriosis	INFBASE15005245

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
24534089	Endometrio sis	26 (14 patients undergoing sur gical treatment for DIE with l ow rectal invol vemen, 12 patie nts without mac roscopic endome triosis undergo ing laparoscopy )		CXCL12 CXCR4	Show abstract
23670619	Endometrio sis	18 ( 9 eutopic endometrial cel ls collected fr om females with endometriosis, 9 eutopic endo metrial cells c ollected from f emales without endometriosis)	Female infertility	CXCR4 SOX2 MET CRMP2 Oct4	Show abstract
23639674	Endometrio sis	32 (13 endometr iosis lesions, 11 isolated end ometriotic-like cells (IELC)-p ositive pelvic sentinel lymph nodes (PSLN), 8 ELC-negative P SLN))		EPCAM CDH1 (E-cadherin) CXCR4 CD44	Show abstract
20720261	Endometrio sis			CXCR4 CXCL12	Show abstract
15005245	Endometrio sis (ovari an)			FCER1G PGDS IL-8 GRO1 GRO2 CXCR4 MCP1 MMP COL4A2 and COL5A2	Show abstract