Endometriosis Knowledgebase

Search Result

Gene id

79602

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ADIPOR2 Gene UCSC Ensembl

Aliases

ACDCR2, PAQR2

Gene name

adiponectin receptor 2

Alternate names

adiponectin receptor protein 2, progestin and adipoQ receptor family member 2, progestin and adipoQ receptor family member II,

Gene location

12p13.33 (1691026: 1788678) Exons: 9 NC_000012.12

Gene summary(Entrez)

The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).[supplied by OMIM, Mar 2008]

OMIM

607946

Protein Summary

Protein general information

Q86V24

Name: Adiponectin receptor protein 2 (Progestin and adipoQ receptor family member 2) (Progestin and adipoQ receptor family member II)

Length: 386 Mass: 43,884

Tissue specificity: Ubiquitous (PubMed

Sequence

MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGF
MGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIW
THLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIAL
LIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE
GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFM
IGGGCSEEDAL

Structural information

Interpro:	IPR004254
Pfam:	PF03006
PDB:	3WXW 5LWY 5LX9 5LXA
PDBsum:	3WXW 5LWY 5LX9 5LXA
STRING:	ENSP00000349616;

Other Databases

GeneCards: ADIPOR2; Malacards: ADIPOR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0009755	hormone-mediated signalin g pathway	ISS	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019395	fatty acid oxidation	ISS	biological_process
GO:0030308	negative regulation of ce ll growth	IEA	biological_process
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0033211	adiponectin-activated sig naling pathway	IDA	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042802	identical protein binding	IEA	molecular_function
GO:0046326	positive regulation of gl ucose import	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0055100	adiponectin binding	IDA	molecular_function
GO:0061042	vascular wound healing	ISS	biological_process
GO:0097003	adipokinetic hormone rece ptor activity	IDA	molecular_function
GO:0004872	receptor activity	IEA	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006631	fatty acid metabolic proc ess	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0009755	hormone-mediated signalin g pathway	ISS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019395	fatty acid oxidation	ISS	biological_process
GO:0030308	negative regulation of ce ll growth	IEA	biological_process
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0033211	adiponectin-activated sig naling pathway	IEA	biological_process
GO:0033211	adiponectin-activated sig naling pathway	IDA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042802	identical protein binding	IEA	molecular_function
GO:0046326	positive regulation of gl ucose import	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0055100	adiponectin binding	IEA	molecular_function
GO:0055100	adiponectin binding	IDA	molecular_function
GO:0061042	vascular wound healing	IEA	biological_process
GO:0061042	vascular wound healing	ISS	biological_process
GO:0097003	adipokinetic hormone rece ptor activity	IDA	molecular_function
GO:0009755	hormone-mediated signalin g pathway	ISS	biological_process
GO:0019395	fatty acid oxidation	ISS	biological_process
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0033211	adiponectin-activated sig naling pathway	IDA	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0055100	adiponectin binding	IDA	molecular_function
GO:0061042	vascular wound healing	ISS	biological_process
GO:0097003	adipokinetic hormone rece ptor activity	IDA	molecular_function

KEGG pathways

hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04152  AMPK signaling pathway

Diseases

Associated diseases	References
Metabolic syndrome	GAD20032495
Hypercholesterolemia	GAD20602615
Alzheimer's disease	GAD19141999
Diabetes	GAD20628086
Cystic fibrosis	GAD19662435
Breast cancer	GAD19723917
Atherosclerosis	GAD20178558
Endometriosis	PubMed26459399

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26459399	Endometrio sis			7 endometrial b iopsies		AdipoR1 AdipoR2	Show abstract