Endometriosis Knowledgebase

Search Result

Gene id

79723

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SUV39H2 Gene UCSC Ensembl

Aliases

KMT1B

Gene name

suppressor of variegation 3-9 homolog 2

Alternate names

histone-lysine N-methyltransferase SUV39H2, H3-K9-HMTase 2, histone H3-K9 methyltransferase 2, lysine N-methyltransferase 1B, su(var)3-9 homolog 2,

Gene location

10p13 (14878782: 14904314) Exons: 8 NC_000010.11

OMIM

606503

Protein Summary

Protein general information

Q9H5I1

Name: Histone lysine N methyltransferase SUV39H2 (EC 2.1.1.43) (Histone H3 K9 methyltransferase 2) (H3 K9 HMTase 2) (Lysine N methyltransferase 1B) (Suppressor of variegation 3 9 homolog 2) (Su(var)3 9 homolog 2)

Length: 410 Mass: 46,682

Sequence

MAAVGAEARGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKDMEYYLVKWKGWPDST
NTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRWQDELNRRKNH
KGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTP
IYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMK
GSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN

Structural information

Protein Domains	Chromo. (47-105) Pre-SET. (189-247) SET. (250-373) Post-SET. (394-410)
Interpro:	IPR000953 IPR023780 IPR016197 IPR023779 IPR011381 IPR003616 IPR007728 IPR001214
Prosite:	PS00598 PS50013 PS50868 PS50867 PS51579 PS50280
Pfam:	PF00385 PF05033 PF00856
PDB:	2R3A
PDBsum:	2R3A
MINT:	3068157
STRING:	ENSP00000346997;

Other Databases

GeneCards: SUV39H2; Malacards: SUV39H2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000775	chromosome, centromeric r egion	IEA	cellular_component
GO:0000785	chromatin	IDA	cellular_component
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0006333	chromatin assembly or dis assembly	IMP	biological_process
GO:0006338	chromatin remodeling	IDA	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0018024	histone-lysine N-methyltr ansferase activity	TAS	molecular_function
GO:0018024	histone-lysine N-methyltr ansferase activity	TAS	molecular_function
GO:0018024	histone-lysine N-methyltr ansferase activity	TAS	molecular_function
GO:0030154	cell differentiation	IEA	biological_process
GO:0036123	histone H3-K9 dimethylati on	ISS	biological_process
GO:0036124	histone H3-K9 trimethylat ion	ISS	biological_process
GO:0042754	negative regulation of ci rcadian rhythm	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046974	histone methyltransferase activity (H3-K9 specific )	IDA	molecular_function
GO:0048511	rhythmic process	IEA	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000775	chromosome, centromeric r egion	IEA	cellular_component
GO:0000775	chromosome, centromeric r egion	IEA	cellular_component
GO:0000785	chromatin	IDA	cellular_component
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0006333	chromatin assembly or dis assembly	IMP	biological_process
GO:0006338	chromatin remodeling	IDA	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0008168	methyltransferase activit y	IEA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0016740	transferase activity	IEA	molecular_function
GO:0018024	histone-lysine N-methyltr ansferase activity	IEA	molecular_function
GO:0018024	histone-lysine N-methyltr ansferase activity	IEA	molecular_function
GO:0018024	histone-lysine N-methyltr ansferase activity	TAS	molecular_function
GO:0018024	histone-lysine N-methyltr ansferase activity	TAS	molecular_function
GO:0018024	histone-lysine N-methyltr ansferase activity	TAS	molecular_function
GO:0030154	cell differentiation	IEA	biological_process
GO:0032259	methylation	IEA	biological_process
GO:0034968	histone lysine methylatio n	IEA	biological_process
GO:0036123	histone H3-K9 dimethylati on	ISS	biological_process
GO:0036124	histone H3-K9 trimethylat ion	ISS	biological_process
GO:0042754	negative regulation of ci rcadian rhythm	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046974	histone methyltransferase activity (H3-K9 specific )	IDA	molecular_function
GO:0048511	rhythmic process	IEA	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000785	chromatin	IDA	cellular_component
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0006333	chromatin assembly or dis assembly	IMP	biological_process
GO:0006338	chromatin remodeling	IDA	biological_process
GO:0018024	histone-lysine N-methyltr ansferase activity	TAS	molecular_function
GO:0018024	histone-lysine N-methyltr ansferase activity	TAS	molecular_function
GO:0018024	histone-lysine N-methyltr ansferase activity	TAS	molecular_function
GO:0036123	histone H3-K9 dimethylati on	ISS	biological_process
GO:0036124	histone H3-K9 trimethylat ion	ISS	biological_process
GO:0042754	negative regulation of ci rcadian rhythm	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046974	histone methyltransferase activity (H3-K9 specific )	IDA	molecular_function
GO:0071456	cellular response to hypo xia	IDA	biological_process

KEGG pathways

hsa00310 Lysine degradation

Diseases

Associated diseases	References
Cancer	PMID: 16774942
Endometriosis	PMID: 23080547
Endometriosis	INFBASE23080547

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23080547	Endometrio sis			15 patients wit h endometriosis	Female infertility	SIRT1 HDAC1 SUV39H1 SUV39H2 HDAC2 G9a	Show abstract