Endometriosis Knowledgebase

Search Result

Gene id

80142

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTGES2 Gene UCSC Ensembl

Aliases

C9orf15, GBF-1, GBF1, PGES2, mPGES-2

Gene name

prostaglandin E synthase 2

Alternate names

prostaglandin E synthase 2, GATE-binding factor 1, gamma-interferon-activated transcriptional element-binding factor 1, mPGE synthase-2, membrane-associated prostaglandin E synthase 2, microsomal prostaglandin E synthase-2, prostaglandin-H(2) E-isomerase,

Gene location

9q34.11 (128128461: 128120692) Exons: 10 NC_000009.12

Gene summary(Entrez)

The protein encoded by this gene is a membrane-associated prostaglandin E synthase, which catalyzes the conversion of prostaglandin H2 to prostaglandin E2. This protein also has been shown to activate the transcription regulated by a gamma-interferon-activated transcription element (GATE). Multiple transcript variants have been found for this gene. [provided by RefSeq, Jun 2009]

OMIM

608152

Protein Summary

Protein general information

Q9H7Z7

Name: Prostaglandin E synthase 2 (Membrane associated prostaglandin E synthase 2) (mPGE synthase 2) (Microsomal prostaglandin E synthase 2) (mPGES 2) (Prostaglandin H(2) E isomerase) (EC 5.3.99.3) [Cleaved into: Prostaglandin E synthase 2 truncated form]

Length: 377 Mass: 41,943

Tissue specificity: Widely expressed. Expressed in the heart, including apex, inter-ventricular septum, both atria and ventricles, but not in the aorta. Also expressed in fetal heart. Detected in various regions of the brain

Sequence

MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLGAAALALGGALGLYHT
ARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPI
LVAQEGESSQQLNDSSVIISALKTYLVSGQPLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGK
EARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQPWYLRVERAITEASP
AH

Structural information

Protein Domains	Glutaredoxin. (90-193) GST (263-377)
Interpro:	IPR002109 IPR010987 IPR004045 IPR034334 IPR034335 IPR012336
Prosite:	PS00195 PS51354 PS50405
Pfam:	PF13417
CDD:	cd03197
STRING:	ENSP00000345341;

Other Databases

GeneCards: PTGES2; Malacards: PTGES2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0009055	electron carrier activity	IEA	molecular_function
GO:0015035	protein disulfide oxidore ductase activity	IEA	molecular_function
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016829	lyase activity	ISS	molecular_function
GO:0020037	heme binding	ISS	molecular_function
GO:0043295	glutathione binding	ISS	molecular_function
GO:0045454	cell redox homeostasis	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0046903	secretion	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0050220	prostaglandin-E synthase activity	IEA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006631	fatty acid metabolic proc ess	IEA	biological_process
GO:0006633	fatty acid biosynthetic p rocess	IEA	biological_process
GO:0006693	prostaglandin metabolic p rocess	IEA	biological_process
GO:0009055	electron carrier activity	IEA	molecular_function
GO:0015035	protein disulfide oxidore ductase activity	IEA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016829	lyase activity	ISS	molecular_function
GO:0016853	isomerase activity	IEA	molecular_function
GO:0020037	heme binding	ISS	molecular_function
GO:0043295	glutathione binding	ISS	molecular_function
GO:0045454	cell redox homeostasis	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0046903	secretion	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0050220	prostaglandin-E synthase activity	IEA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0016829	lyase activity	ISS	molecular_function
GO:0020037	heme binding	ISS	molecular_function
GO:0043295	glutathione binding	ISS	molecular_function

KEGG pathways

hsa01100 Metabolic pathways
hsa00590 Arachidonic acid metabolism

Diseases

Associated diseases	References
Diabetes	PMID: 19371221
Endometriosis	PMID: 24035605
Endometriosis	INFBASE24035605
Penile cancer	KEGG: H00025

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24035605	Endometrio sis			74 (45 women wi th endometriosi s, 29 normal co ntrols)	Female infertility	Cox-2 mPGES-1 mPGES-2 cPGES and AKR-1C3	Show abstract