Endometriosis Knowledgebase

Search Result

Gene id

80155

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NAA15 Gene UCSC Ensembl

Aliases

Ga19, NARG1, NAT1P, NATH, TBDN, TBDN100

Gene name

N(alpha)-acetyltransferase 15, NatA auxiliary subunit

Alternate names

N-alpha-acetyltransferase 15, NatA auxiliary subunit, N-terminal acetyltransferase, NMDA receptor regulated 1, NMDA receptor-regulated protein 1, gastric cancer antigen Ga19, protein tubedown-1, transcriptional coactivator tubedown-100, tubedown-1,

Gene location

4q31.1 (139301466: 139390780) Exons: 20 NC_000004.12

Gene summary(Entrez)

N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for normal cell function. This gene encodes the auxillary subunit of the N-terminal acetyltransferase A (NatA) complex. [provided by RefSeq, Jan 2017]

OMIM

608000

Protein Summary

Protein general information

Q9BXJ9

Name: N alpha acetyltransferase 15, NatA auxiliary subunit (Gastric cancer antigen Ga19) (N terminal acetyltransferase) (NMDA receptor regulated protein 1) (Protein tubedown 1) (Tbdn100)

Length: 866 Mass: 101,272

Tissue specificity: Expressed at high levels in testis and in ocular endothelial cells. Also found in brain (corpus callosum), heart, colon, bone marrow and at lower levels in most adult tissues, including thyroid, liver, pancreas, mammary and salivary gl

Sequence

MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEAYELVRRGLRN
DLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRYQLLQLRPAQRAS
WIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLA
VEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNF
LSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTTLLW
VQYYLAQHYDKIGQPSIALEYINTAIESTPTLIELFLVKAKIYKHAGNIKEAARWMDEAQALDTADRFINSKCAK
YMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQAYKAMNKFGEALKKCHEIERHFIEITDDQFDF
HTYCMRKITLRSYVDLLKLEDVLRQHPFYFKAARIAIEIYLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQR
RAQKKAQIEEEKKNAEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETH
LFAFEIYFRKEKFLLMLQSVKRAFAIDSSHPWLHECMIRLFNTAVCESKDLSDTVRTVLKQEMNRLFGATNPKNF
NETFLKRNSDSLPHRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYR
ANCHKLFPYALAFMPPGYEEDMKITVNGDSSAEAEELANEI

Structural information

Motifs	Bipartite nuclear(612-629)
Interpro:	IPR011989 IPR021183 IPR013026 IPR011990 IPR019734
Prosite:	PS50005 PS50293
Pfam:	PF12569 PF13181
STRING:	ENSP00000296543;

Other Databases

GeneCards: NAA15; Malacards: NAA15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005667	transcription factor comp lex	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0017196	N-terminal peptidyl-methi onine acetylation	IBA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0031415	NatA complex	IDA	cellular_component
GO:0043022	ribosome binding	IDA	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0004596	peptide alpha-N-acetyltra nsferase activity	IBA	molecular_function
GO:0016407	acetyltransferase activit y	IDA	molecular_function
GO:0043022	ribosome binding	IDA	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005667	transcription factor comp lex	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0017196	N-terminal peptidyl-methi onine acetylation	IBA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0031415	NatA complex	IDA	cellular_component
GO:0043022	ribosome binding	IDA	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0004596	peptide alpha-N-acetyltra nsferase activity	IBA	molecular_function
GO:0016407	acetyltransferase activit y	IDA	molecular_function
GO:0043022	ribosome binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005667	transcription factor comp lex	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0017196	N-terminal peptidyl-methi onine acetylation	IBA	biological_process
GO:0031415	NatA complex	IDA	cellular_component
GO:0043022	ribosome binding	IDA	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0004596	peptide alpha-N-acetyltra nsferase activity	IBA	molecular_function
GO:0016407	acetyltransferase activit y	IDA	molecular_function
GO:0043022	ribosome binding	IDA	molecular_function

Diseases

Associated diseases	References
Endometriosis	PMID: 22276910
Endometriosis	INFBASE22276910

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22276910	Endometrio sis			100 (50 endomet riosis, 50 cont rols)		COX-2 BRAF NRAS CFL1 MAT2A SEPT9 ATAD3A CADM2 NAA15 and CCDC21	Show abstract