Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 80328
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol ULBP2   Gene   UCSC   Ensembl
Aliases ALCAN-alpha, N2DL2, NKG2DL2, RAET1H
Gene name UL16 binding protein 2
Alternate names NKG2D ligand 2, retinoic acid early transcript 1H,
Gene location 6q25.1 (149941937: 149949234)     Exons: 5     NC_000006.12
Gene summary(Entrez) This gene encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activation of NK cells. The encoded protein undergoes further processing to generate the mature protein that is either anchored to membrane via a glycosylphosphatidylinositol moiety, or secreted. Many malignant cells secrete the encoded protein to evade immunosurveillance by NK cells. This gene is located in a cluster of multiple MHC class I-related genes on chromosome 6. [provided by RefSeq, Jul 2015]
OMIM 605698

Protein Summary

Protein general information Q9BZM5  

Name: NKG2D ligand 2 (N2DL 2) (NKG2DL2) (ALCAN alpha) (Retinoic acid early transcript 1H) (UL16 binding protein 2)

Length: 246  Mass: 27,368

Tissue specificity: Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues. {ECO

Sequence MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVS
PLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLL
FDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRAT
ATTLILCCLLIILPCFILPGI
Structural information
Interpro:  IPR011161 IPR011162

Pfam:  
PF00129
STRING:   ENSP00000356320;
Other Databases GeneCards:  ULBP2;  Malacards:  ULBP2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0003823 antigen binding
IBA molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0019882 antigen processing and pr
esentation
IBA biological_process
GO:0030101 natural killer cell activ
ation
IDA biological_process
GO:0042267 natural killer cell media
ted cytotoxicity
IDA biological_process
GO:0046658 anchored component of pla
sma membrane
IDA cellular_component
GO:0046703 natural killer cell lecti
n-like receptor binding
IDA molecular_function
GO:0003823 antigen binding
IBA molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0006955 immune response
IEA biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0016020 membrane
IEA cellular_component
GO:0019882 antigen processing and pr
esentation
IBA biological_process
GO:0030101 natural killer cell activ
ation
IDA biological_process
GO:0031225 anchored component of mem
brane
IEA cellular_component
GO:0042267 natural killer cell media
ted cytotoxicity
IDA biological_process
GO:0046658 anchored component of pla
sma membrane
IDA cellular_component
GO:0046703 natural killer cell lecti
n-like receptor binding
IDA molecular_function
GO:0003823 antigen binding
IBA molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0019882 antigen processing and pr
esentation
IBA biological_process
GO:0030101 natural killer cell activ
ation
IDA biological_process
GO:0042267 natural killer cell media
ted cytotoxicity
IDA biological_process
GO:0046658 anchored component of pla
sma membrane
IDA cellular_component
GO:0046703 natural killer cell lecti
n-like receptor binding
IDA molecular_function

KEGG pathways

hsa04650  Natural killer cell mediated cytotoxicity

Diseases

Associated diseases References
Endometriosis PMID: 25775242
Endometriosis INFBASE25775242

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
25775242 Endometrio
sis

202 (121 women
with histologic
ally proven end
ometriosis, 81
endometriosis-f
ree controls )
MICB
MICA
ULBP2
Show abstract