Endometriosis Knowledgebase

Search Result

Gene id

80328

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ULBP2 Gene UCSC Ensembl

Aliases

ALCAN-alpha, N2DL2, NKG2DL2, RAET1H

Gene name

UL16 binding protein 2

Alternate names

NKG2D ligand 2, retinoic acid early transcript 1H,

Gene location

6q25.1 (149941937: 149949234) Exons: 5 NC_000006.12

Gene summary(Entrez)

This gene encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activation of NK cells. The encoded protein undergoes further processing to generate the mature protein that is either anchored to membrane via a glycosylphosphatidylinositol moiety, or secreted. Many malignant cells secrete the encoded protein to evade immunosurveillance by NK cells. This gene is located in a cluster of multiple MHC class I-related genes on chromosome 6. [provided by RefSeq, Jul 2015]

OMIM

605698

Protein Summary

Protein general information

Q9BZM5

Name: NKG2D ligand 2 (N2DL 2) (NKG2DL2) (ALCAN alpha) (Retinoic acid early transcript 1H) (UL16 binding protein 2)

Length: 246 Mass: 27,368

Tissue specificity: Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues. {ECO

Sequence

MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVS
PLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLL
FDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRAT
ATTLILCCLLIILPCFILPGI

Structural information

Interpro:	IPR011161 IPR011162
Pfam:	PF00129
STRING:	ENSP00000356320;

Other Databases

GeneCards: ULBP2; Malacards: ULBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003823	antigen binding	IBA	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0019882	antigen processing and pr esentation	IBA	biological_process
GO:0030101	natural killer cell activ ation	IDA	biological_process
GO:0042267	natural killer cell media ted cytotoxicity	IDA	biological_process
GO:0046658	anchored component of pla sma membrane	IDA	cellular_component
GO:0046703	natural killer cell lecti n-like receptor binding	IDA	molecular_function
GO:0003823	antigen binding	IBA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006955	immune response	IEA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0019882	antigen processing and pr esentation	IBA	biological_process
GO:0030101	natural killer cell activ ation	IDA	biological_process
GO:0031225	anchored component of mem brane	IEA	cellular_component
GO:0042267	natural killer cell media ted cytotoxicity	IDA	biological_process
GO:0046658	anchored component of pla sma membrane	IDA	cellular_component
GO:0046703	natural killer cell lecti n-like receptor binding	IDA	molecular_function
GO:0003823	antigen binding	IBA	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0019882	antigen processing and pr esentation	IBA	biological_process
GO:0030101	natural killer cell activ ation	IDA	biological_process
GO:0042267	natural killer cell media ted cytotoxicity	IDA	biological_process
GO:0046658	anchored component of pla sma membrane	IDA	cellular_component
GO:0046703	natural killer cell lecti n-like receptor binding	IDA	molecular_function

KEGG pathways

hsa04650 Natural killer cell mediated cytotoxicity

Diseases

Associated diseases	References
Endometriosis	PMID: 25775242
Endometriosis	INFBASE25775242

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25775242	Endometrio sis			202 (121 women with histologic ally proven end ometriosis, 81 endometriosis-f ree controls )		MICB MICA ULBP2	Show abstract