Endometriosis Knowledgebase

Search Result

Gene id

81607

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NECTIN4 Gene UCSC Ensembl

Aliases

EDSS1, LNIR, PRR4, PVRL4, nectin-4

Gene name

nectin cell adhesion molecule 4

Alternate names

nectin-4, Ig superfamily receptor LNIR, nectin 4, poliovirus receptor-related 4, poliovirus receptor-related protein 4,

Gene location

1q23.3 (161089594: 161070990) Exons: 9 NC_000001.11

Gene summary(Entrez)

This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.[provided by RefSeq, Jan 2011]

OMIM

609607

Protein Summary

Protein general information

Q96NY8

Name: Nectin 4 (Ig superfamily receptor LNIR) (Nectin cell adhesion molecule 4) (Poliovirus receptor related protein 4) [Cleaved into: Processed poliovirus receptor related protein 4]

Length: 510 Mass: 55,454

Tissue specificity: Predominantly expressed in placenta. Not detected in normal breast epithelium but expressed in breast carcinoma. {ECO

Sequence

MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEG
AQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPL
PSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVV
SHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTL
GFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASVVVVGVIAALLFCLLVVVVVLMSRYH
RRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTT
VREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV

Structural information

Protein Domains	Ig-like (32-144) Ig-like (148-237) Ig-like (248-331)
Interpro:	IPR013162 IPR007110 IPR013783 IPR003599 IPR003598 IPR013106 IPR033320
Prosite:	PS50835
Pfam:	PF08205 PF07686
PDB:	4FRW 4GJT 4JJH
PDBsum:	4FRW 4GJT 4JJH
DIP:	41492
MINT:	237395
STRING:	ENSP00000356991;

Other Databases

GeneCards: NECTIN4; Malacards: NECTIN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0004872	receptor activity	IBA	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0005913	cell-cell adherens juncti on	IBA	cellular_component
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IBA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IBA	biological_process
GO:0008037	cell recognition	IBA	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0046718	viral entry into host cel l	IEA	biological_process
GO:0050839	cell adhesion molecule bi nding	IBA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0004872	receptor activity	IBA	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0005912	adherens junction	IEA	cellular_component
GO:0005913	cell-cell adherens juncti on	IBA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IBA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IBA	biological_process
GO:0008037	cell recognition	IBA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0030054	cell junction	IEA	cellular_component
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0046718	viral entry into host cel l	IEA	biological_process
GO:0050839	cell adhesion molecule bi nding	IBA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0004872	receptor activity	IBA	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0005913	cell-cell adherens juncti on	IBA	cellular_component
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IBA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IBA	biological_process
GO:0008037	cell recognition	IBA	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IBA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa04520 Adherens junction

Diseases

Associated diseases	References
Ectodermal dysplasia syndactyly syndrome	KEGG: H00647
Endometriosis	PMID: 27328518
Endometriosis	INFBASE27328518

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22926846	Endometrio sis			75 (55 women un dergoing endome trial biopsy or surgery for en dometriosis (20 proliferative endometrium fro m women with en dometriosis, pr oliferative end ometrium from w omen without en dometriosis, 20 peritoneal end ometriosis, 20 ovarian endomet riosis, 20 colo		Nectin-1 -3 -4 and Necl-2	Show abstract
27328518	Endometrio sis			80 (20 women wi th ovarian endo metriosis, 20 w omen with perit oneal endometri osis, 20 women with endometriu m of endometrio sis, 20 women i n a control gro up (having no e ndometriosis))			Show abstract