Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 8290
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol HIST3H3   Gene   UCSC   Ensembl
Aliases H3.4, H3/g, H3FT, H3t
Gene name histone cluster 3 H3
Alternate names histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3,
Gene location 1q42.13 (228425324: 228424844)     Exons: 1     NC_000001.11
Gene summary(Entrez) Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015]
OMIM 602820

Protein Summary

Protein general information Q16695  

Name: Histone H3.1t (H3/t) (H3t) (H3/g)

Length: 136  Mass: 15,508

Tissue specificity: Expressed in testicular cells.

Sequence MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREI
AQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Structural information
Interpro:  IPR009072 IPR007125 IPR000164
Prosite:   PS00322

Pfam:  
PF00125

PDB:  
2V1D 2YBP 2YBS 3A6N 3T6R 4V2V 4V2W
PDBsum:   2V1D 2YBP 2YBS 3A6N 3T6R 4V2V 4V2W

DIP:  
922
MINT:   1155005
STRING:   ENSP00000355657;
Other Databases GeneCards:  HIST3H3;  Malacards:  HIST3H3

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000786 nucleosome
IDA cellular_component
GO:0000788 nuclear nucleosome
IDA cellular_component
GO:0003677 DNA binding
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0006303 double-strand break repai
r via nonhomologous end j
oining
TAS biological_process
GO:0006334 nucleosome assembly
IMP biological_process
GO:0006334 nucleosome assembly
IDA biological_process
GO:0016233 telomere capping
TAS biological_process
GO:0016233 telomere capping
TAS biological_process
GO:0032460 negative regulation of pr
otein oligomerization
IMP biological_process
GO:0042393 histone binding
IPI molecular_function
GO:0042393 histone binding
IPI molecular_function
GO:0046982 protein heterodimerizatio
n activity
IEA molecular_function
GO:0051290 protein heterotetrameriza
tion
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0000786 nucleosome
IEA cellular_component
GO:0000786 nucleosome
IEA cellular_component
GO:0000786 nucleosome
IDA cellular_component
GO:0000788 nuclear nucleosome
IDA cellular_component
GO:0003677 DNA binding
IEA molecular_function
GO:0003677 DNA binding
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005694 chromosome
IEA cellular_component
GO:0005694 chromosome
IEA cellular_component
GO:0006303 double-strand break repai
r via nonhomologous end j
oining
TAS biological_process
GO:0006334 nucleosome assembly
IMP biological_process
GO:0006334 nucleosome assembly
IDA biological_process
GO:0016233 telomere capping
TAS biological_process
GO:0016233 telomere capping
TAS biological_process
GO:0032460 negative regulation of pr
otein oligomerization
IMP biological_process
GO:0042393 histone binding
IPI molecular_function
GO:0042393 histone binding
IPI molecular_function
GO:0046982 protein heterodimerizatio
n activity
IEA molecular_function
GO:0051290 protein heterotetrameriza
tion
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0000786 nucleosome
IDA cellular_component
GO:0000788 nuclear nucleosome
IDA cellular_component
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0006303 double-strand break repai
r via nonhomologous end j
oining
TAS biological_process
GO:0006334 nucleosome assembly
IMP biological_process
GO:0006334 nucleosome assembly
IDA biological_process
GO:0016233 telomere capping
TAS biological_process
GO:0016233 telomere capping
TAS biological_process
GO:0032460 negative regulation of pr
otein oligomerization
IMP biological_process
GO:0042393 histone binding
IPI molecular_function
GO:0042393 histone binding
IPI molecular_function
GO:0051290 protein heterotetrameriza
tion
IDA biological_process
GO:0070062 extracellular exosome
IDA cellular_component

KEGG pathways

hsa05202  Transcriptional misregulation in cancer
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus

Diseases

Associated diseases References
Endometriosis PMID: 25820690
Polycystic ovary syndrome (PCOS) PMID: 17008325
Endometriosis INFBASE25820690

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
25820690 Endometrio
sis


H3K27me3
EZH2
Show abstract