Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 83716
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CRISPLD2   Gene   UCSC   Ensembl
Aliases CRISP11, LCRISP2, LGL1
Gene name cysteine rich secretory protein LCCL domain containing 2
Alternate names cysteine-rich secretory protein LCCL domain-containing 2, CRISP-11, LCCL domain-containing cysteine-rich secretory protein 2, cysteine-rich secretory protein 11, late gestation lung 1, testis secretory sperm-binding protein Li 207a, trypsin inhibitor,
Gene location 16q24.1 (84819980: 84909509)     Exons: 16     NC_000016.10
OMIM 612434

Protein Summary

Protein general information Q9H0B8  

Name: Cysteine-rich secretory protein LCCL domain-containing 2 (Cysteine-rich secretory protein 11) (CRISP-11) (LCCL domain-containing cysteine-rich secretory protein 2)

Length: 497  Mass: 55,920

Sequence MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQVQPQAS
NMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWC
PERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSY
GGSCRNNLCYREETYTPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKG
STCNRYQCPAGCLNHKAKIFGTLFYESSSSICRAAIHYGILDDKGGLVDITRNGKVPFFVKSERHGVQSLSKYKP
SSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDEPSYWAPVFGTNIYADTSSICKTAVHAGVIS
NESGGDVDVMPVDKKKTYVGSLRNGVQSESLGTPRDGKAFRIFAVRQ
Structural information
Protein Domains
SCP (62-200)
LCCL (284-379)
LCCL (385-488)
Interpro:  IPR001283 IPR018244 IPR014044 IPR035940 IPR004043 IPR036609
Prosite:   PS01010 PS50820

Pfam:  
PF00188 PF03815
STRING:   ENSP00000262424;
Other Databases GeneCards:  CRISPLD2;  Malacards:  CRISPLD2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0005578 proteinaceous extracellul
ar matrix
IEA cellular_component
GO:0008201 heparin binding
IEA molecular_function
GO:0030133 transport vesicle
IDA cellular_component
GO:0030198 extracellular matrix orga
nization
IEA biological_process
GO:0030324 lung development
IEA biological_process
GO:0060325 face morphogenesis
IMP biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0005539 glycosaminoglycan binding
IEA molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005578 proteinaceous extracellul
ar matrix
IEA cellular_component
GO:0008201 heparin binding
IEA molecular_function
GO:0030133 transport vesicle
IDA cellular_component
GO:0030198 extracellular matrix orga
nization
IEA biological_process
GO:0030324 lung development
IEA biological_process
GO:0060325 face morphogenesis
IMP biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0030133 transport vesicle
IDA cellular_component
GO:0060325 face morphogenesis
IMP biological_process
GO:0070062 extracellular exosome
IDA cellular_component

Diseases

Associated diseases References
Diabetes GAD20536507
Cleft lip with cleft palate GAD17616516
Endometriosis PubMed24955763

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
24955763 Endometrio
sis



Show abstract