Endometriosis Knowledgebase

Search Result

Gene id

8431

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NR0B2 Gene UCSC Ensembl

Aliases

SHP, SHP1

Gene name

nuclear receptor subfamily 0 group B member 2

Alternate names

nuclear receptor subfamily 0 group B member 2, nuclear receptor SHP, orphan nuclear receptor SHP, small heterodimer partner,

Gene location

1p36.11 (26914075: 26911483) Exons: 3 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. The gene product is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function. Studies suggest that the protein represses nuclear hormone receptor-mediated transactivation via two separate steps: competition with coactivators and the direct effects of its transcriptional repressor function. [provided by RefSeq, Jul 2008]

OMIM

604630

Protein Summary

Protein general information

Q15466

Name: Nuclear receptor subfamily 0 group B member 2 (Orphan nuclear receptor SHP) (Small heterodimer partner)

Length: 257 Mass: 28,058

Tissue specificity: Liver. Low levels of expression were detected in heart and pancreas. {ECO

Sequence

MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREALDVLAKTVAFLRNLPS
FWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQ
CCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLK
SIPTSLLGDLFFRPIIGDVDIAGLLGDMLLLR

Structural information

Interpro:	IPR000536 IPR001723
Pfam:	PF00104
PDB:	1YUC 2Q3Y 2Z4J 4DOR 4ONI
PDBsum:	1YUC 2Q3Y 2Z4J 4DOR 4ONI
DIP:	46313
MINT:	8150838
STRING:	ENSP00000254227;

Other Databases

GeneCards: NR0B2; Malacards: NR0B2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003707	steroid hormone receptor activity	IEA	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0008134	transcription factor bind ing	IBA	molecular_function
GO:0008203	cholesterol metabolic pro cess	TAS	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0032024	positive regulation of in sulin secretion	IEA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0042975	peroxisome proliferator a ctivated receptor binding	IEA	molecular_function
GO:0043234	protein complex	IEA	cellular_component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0046965	retinoid X receptor bindi ng	IEA	molecular_function
GO:0046966	thyroid hormone receptor binding	IEA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003707	steroid hormone receptor activity	IEA	molecular_function
GO:0003714	transcription corepressor activity	TAS	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008134	transcription factor bind ing	IBA	molecular_function
GO:0008203	cholesterol metabolic pro cess	TAS	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0032024	positive regulation of in sulin secretion	IEA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0042974	retinoic acid receptor bi nding	IEA	molecular_function
GO:0042975	peroxisome proliferator a ctivated receptor binding	IEA	molecular_function
GO:0043234	protein complex	IEA	cellular_component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0046965	retinoid X receptor bindi ng	IEA	molecular_function
GO:0046966	thyroid hormone receptor binding	IEA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0003714	transcription corepressor activity	TAS	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0008134	transcription factor bind ing	IBA	molecular_function
GO:0008203	cholesterol metabolic pro cess	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process

KEGG pathways

hsa04976 Bile secretion

Diseases

Associated diseases	References
Diabetes	PMID: 18781616
Endometriosis	PMID: 21613300
Obesity	PMID: 11136233
Endometriosis	INFBASE21613300

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21613300	Endometrio sis			20 (10 women wi th endometriosi s, 10 control w omen)		COX-2 CDX1 SHP HIF-1	Show abstract