Endometriosis Knowledgebase

Search Result

Gene id

84432

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PROK1 Gene UCSC Ensembl

Aliases

EGVEGF, PK1, PRK1

Gene name

prokineticin 1

Alternate names

prokineticin-1, EG-VEGF, black mamba toxin-related protein, endocrine-gland-derived vascular endothelial growth factor, mambakine,

Gene location

1p13.3 (110451165: 110457353) Exons: 3 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene induces proliferation, migration, and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It has little or no effect on a variety of other endothelial and non-endothelial cell types. Its expression is restricted to the steroidogenic glands (ovary, testis, adrenal, and placenta), is induced by hypoxia, and often complementary to the expression of vascular endothelial growth factor (VEGF), suggesting that these molecules function in a coordinated manner. [provided by RefSeq, Sep 2011]

OMIM

606233

Protein Summary

Protein general information

P58294

Name: Prokineticin 1 (Endocrine gland derived vascular endothelial growth factor) (EG VEGF) (Mambakine)

Length: 105 Mass: 11,715

Tissue specificity: Localizes to glandular epithelium, stroma and vascular epithelial cells of first trimester decidua (at protein level). Up-regulated in first trimester decidua when compared with non-pregnant endometrium. Expressed in the steroidogenic

Sequence

MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKH
HTCPCLPNLLCSRFPDGRYRCSMDLKNINF

Structural information

Interpro:	IPR009523 IPR023569
Pfam:	PF06607
STRING:	ENSP00000271331;

Other Databases

GeneCards: PROK1; Malacards: PROK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activi ty	IBA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001664	G-protein coupled recepto r binding	IBA	molecular_function
GO:0005576	extracellular region	IBA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0007623	circadian rhythm	IBA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IBA	biological_process
GO:0045765	regulation of angiogenesi s	IBA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0000187	activation of MAPK activi ty	IEA	biological_process
GO:0000187	activation of MAPK activi ty	IBA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001664	G-protein coupled recepto r binding	IBA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IBA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0007623	circadian rhythm	IBA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IBA	biological_process
GO:0045765	regulation of angiogenesi s	IEA	biological_process
GO:0045765	regulation of angiogenesi s	IBA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0000187	activation of MAPK activi ty	IBA	biological_process
GO:0001664	G-protein coupled recepto r binding	IBA	molecular_function
GO:0005576	extracellular region	IBA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0007623	circadian rhythm	IBA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IBA	biological_process
GO:0045765	regulation of angiogenesi s	IBA	biological_process

Diseases

Associated diseases	References
Embryo implantation	PMID: 26401590
Endometriosis	PMID: 20400074
Endometriosis	INFBASE19285664
Oligozoospermia	PMID: 18596028

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20400074	Endometrio sis			24 (12 normal c ontrols, 12 pat ients affected by moderate to severe endometr iosi)		PROK1 HOXA10 and PR	Show abstract
19285664	Endometrio sis			24 (12 patients affected by en dometriosis, 12 control women)			Show abstract