Endometriosis Knowledgebase

Search Result

Gene id

8462

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

KLF11 Gene UCSC Ensembl

Aliases

FKLF, FKLF1, MODY7, TIEG2, Tieg3

Gene name

Kruppel like factor 11

Alternate names

Krueppel-like factor 11, TGFB-inducible early growth response protein 2, TIEG-2, transforming growth factor-beta-inducible early growth response protein 2,

Gene location

2p25.1 (10043554: 10054835) Exons: 6 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset diabetes of the young type 7 (MODY7). Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]

OMIM

603301

Protein Summary

Protein general information

O14901

Name: Krueppel-like factor 11 (Transforming growth factor-beta-inducible early growth response protein 2) (TGFB-inducible early growth response protein 2) (TIEG-2)

Length: 512 Mass: 55,139

Tissue specificity: Ubiquitous. Higher expression in erythroid cells. {ECO

Sequence

MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPV
SDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTRTPVSPQVTDSKACTATDVLQSSAVVARALS
GGAERGLLGLEPVPSSPCRAKGTSVIRHTGESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLS
TNLVSCQPCLHKSGGLLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLP
AFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMAAGNTKLLPLAPAPVF
ITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTG
EKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA

Structural information

Interpro:	IPR036236 IPR013087
Prosite:	PS00028 PS50157
PDB:	1PO4
PDBsum:	1PO4
STRING:	ENSP00000307023;

Other Databases

GeneCards: KLF11; Malacards: KLF11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000083	regulation of transcripti on involved in G1/S trans ition of mitotic cell cyc le	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0000083	regulation of transcripti on involved in G1/S trans ition of mitotic cell cyc le	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IDA	molecular_function
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0000083	regulation of transcripti on involved in G1/S trans ition of mitotic cell cyc le	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	TAS	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function

Diseases

Associated diseases	References
Endometriosis	INFBASE27488034
Maturity-onset diabetes of the young, type VII	OMIM603301
Maturity onset diabetes of the young (MODY)	KEGGH00410

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27488034	Endometrio sis						Show abstract