Endometriosis Knowledgebase

Search Result

Gene id

847

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CAT Gene UCSC Ensembl

Gene name

catalase

Alternate names

catalase,

Gene location

11p13 (34438924: 34472059) Exons: 13 NC_000011.10

Gene summary(Entrez)

This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide to water and oxygen and thereby mitigates the toxic effects of hydrogen peroxide. Oxidative stress is hypothesized to play a role in the development of many chronic or late-onset diseases such as diabetes, asthma, Alzheimer's disease, systemic lupus erythematosus, rheumatoid arthritis, and cancers. Polymorphisms in this gene have been associated with decreases in catalase activity but, to date, acatalasemia is the only disease known to be caused by this gene. [provided by RefSeq, Oct 2009]

OMIM

115500

Protein Summary

Protein general information

P04040

Name: Catalase (EC 1.11.1.6)

Length: 527 Mass: 59,756

Sequence

MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVH
AKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNT
PIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNA
NGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLT
KVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPV
NCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNV
LNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKA
NL

Structural information

Interpro:	IPR018028 IPR020835 IPR024708 IPR024711 IPR011614 IPR002226 IPR010582
Prosite:	PS00437 PS00438 PS51402
Pfam:	PF00199 PF06628
PDB:	1DGB 1DGF 1DGG 1DGH 1F4J 1QQW
PDBsum:	1DGB 1DGF 1DGG 1DGH 1F4J 1QQW
MINT:	1210583
STRING:	ENSP00000241052;

Other Databases

GeneCards: CAT; Malacards: CAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000302	response to reactive oxyg en species	IMP	biological_process
GO:0000302	response to reactive oxyg en species	TAS	biological_process
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0001657	ureteric bud development	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0004046	aminoacylase activity	IEA	molecular_function
GO:0004096	catalase activity	IDA	molecular_function
GO:0004096	catalase activity	IDA	molecular_function
GO:0004096	catalase activity	IDA	molecular_function
GO:0004096	catalase activity	TAS	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005615	extracellular space	IEA	cellular_component
GO:0005739	mitochondrion	IBA	cellular_component
GO:0005758	mitochondrial intermembra ne space	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005778	peroxisomal membrane	ISS	cellular_component
GO:0005782	peroxisomal matrix	TAS	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006195	purine nucleotide catabol ic process	TAS	biological_process
GO:0006641	triglyceride metabolic pr ocess	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008203	cholesterol metabolic pro cess	IEA	biological_process
GO:0009060	aerobic respiration	IEA	biological_process
GO:0009642	response to light intensi ty	IEA	biological_process
GO:0009650	UV protection	IMP	biological_process
GO:0009650	UV protection	IMP	biological_process
GO:0010193	response to ozone	IEA	biological_process
GO:0010288	response to lead ion	IEA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014854	response to inactivity	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016209	antioxidant activity	IDA	molecular_function
GO:0016684	oxidoreductase activity, acting on peroxide as acc eptor	ISS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0020027	hemoglobin metabolic proc ess	IEA	biological_process
GO:0020037	heme binding	IDA	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0033189	response to vitamin A	IEA	biological_process
GO:0033197	response to vitamin E	IEA	biological_process
GO:0033591	response to L-ascorbic ac id	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042542	response to hydrogen pero xide	IBA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0045471	response to ethanol	IEA	biological_process
GO:0046686	response to cadmium ion	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050661	NADP binding	IDA	molecular_function
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051289	protein homotetramerizati on	IDA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0055093	response to hyperoxia	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070542	response to fatty acid	IEA	biological_process
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0080184	response to phenylpropano id	IEA	biological_process
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0000302	response to reactive oxyg en species	IEA	biological_process
GO:0000302	response to reactive oxyg en species	IMP	biological_process
GO:0000302	response to reactive oxyg en species	TAS	biological_process
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0001657	ureteric bud development	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001822	kidney development	IEA	biological_process
GO:0004046	aminoacylase activity	IEA	molecular_function
GO:0004096	catalase activity	IEA	molecular_function
GO:0004096	catalase activity	IEA	molecular_function
GO:0004096	catalase activity	IEA	molecular_function
GO:0004096	catalase activity	IDA	molecular_function
GO:0004096	catalase activity	IDA	molecular_function
GO:0004096	catalase activity	IDA	molecular_function
GO:0004096	catalase activity	TAS	molecular_function
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005615	extracellular space	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IBA	cellular_component
GO:0005758	mitochondrial intermembra ne space	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005777	peroxisome	IEA	cellular_component
GO:0005777	peroxisome	IEA	cellular_component
GO:0005777	peroxisome	IEA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005778	peroxisomal membrane	IEA	cellular_component
GO:0005778	peroxisomal membrane	ISS	cellular_component
GO:0005782	peroxisomal matrix	TAS	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006195	purine nucleotide catabol ic process	TAS	biological_process
GO:0006641	triglyceride metabolic pr ocess	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008203	cholesterol metabolic pro cess	IEA	biological_process
GO:0009060	aerobic respiration	IEA	biological_process
GO:0009314	response to radiation	IEA	biological_process
GO:0009411	response to UV	IEA	biological_process
GO:0009636	response to toxic substan ce	IEA	biological_process
GO:0009642	response to light intensi ty	IEA	biological_process
GO:0009650	UV protection	IMP	biological_process
GO:0009650	UV protection	IMP	biological_process
GO:0010193	response to ozone	IEA	biological_process
GO:0010288	response to lead ion	IEA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014854	response to inactivity	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016209	antioxidant activity	IDA	molecular_function
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016684	oxidoreductase activity, acting on peroxide as acc eptor	IEA	molecular_function
GO:0016684	oxidoreductase activity, acting on peroxide as acc eptor	ISS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0020027	hemoglobin metabolic proc ess	IEA	biological_process
GO:0020037	heme binding	IEA	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0033189	response to vitamin A	IEA	biological_process
GO:0033197	response to vitamin E	IEA	biological_process
GO:0033591	response to L-ascorbic ac id	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042542	response to hydrogen pero xide	IBA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IEA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IEA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0045471	response to ethanol	IEA	biological_process
GO:0046686	response to cadmium ion	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050661	NADP binding	IDA	molecular_function
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051289	protein homotetramerizati on	IDA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0055093	response to hyperoxia	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070542	response to fatty acid	IEA	biological_process
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0080184	response to phenylpropano id	IEA	biological_process
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0000302	response to reactive oxyg en species	IMP	biological_process
GO:0000302	response to reactive oxyg en species	TAS	biological_process
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0004096	catalase activity	IDA	molecular_function
GO:0004096	catalase activity	IDA	molecular_function
GO:0004096	catalase activity	IDA	molecular_function
GO:0004096	catalase activity	TAS	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005739	mitochondrion	IBA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005778	peroxisomal membrane	ISS	cellular_component
GO:0005782	peroxisomal matrix	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006195	purine nucleotide catabol ic process	TAS	biological_process
GO:0009650	UV protection	IMP	biological_process
GO:0009650	UV protection	IMP	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016209	antioxidant activity	IDA	molecular_function
GO:0016684	oxidoreductase activity, acting on peroxide as acc eptor	ISS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0042542	response to hydrogen pero xide	IBA	biological_process
GO:0042744	hydrogen peroxide catabol ic process	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0050661	NADP binding	IDA	molecular_function
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051289	protein homotetramerizati on	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa04068  FoxO signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway
hsa01200  Carbon metabolism
hsa05014  Amyotrophic lateral sclerosis
hsa04146  Peroxisome
hsa00380  Tryptophan metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
PTHR22589:SF14  Nicotinic acetylcholine receptor signaling pathway
PTHR22589:SF14  Muscarinic acetylcholine receptor 1 and 3 signaling pathway
PTHR22589:SF14  Muscarinic acetylcholine receptor 2 and 4 signaling pathway

Diseases

Associated diseases	References
Acatalasemia	OMIM: 115500
Adenomyosis	PMID: 12372460
Alzheimer's disease	PMID: 12231449
Asthma	PMID: 16385446
Cancer	PMID: 17634480
Diabetes	PMID: 12469627
Diabetes	PMID: 17264407
Diabetic neuropathy	PMID: 15125229
Endometriosis	PMID: 12372460
Gastric disease	PMID: 17549373
Hearing loss	PMID: 17567781
Hypertension	PMID: 11479740
Macular degeneration	PMID: 15774926
Male infertility	PMID: 26198800
Pancreatitis	PMID: 15131792
Preeclampsia	PMID: 19399816
Adenomyosis	INFBASE12372460
Endometriosis	INFBASE12372460
Varicocele	PMID: 22086312
Vitiligo	PMID: 11837458

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12372460	Endometrio sis			116 (33 patient s with endometr iosis, 36 with adenomyosis, 47 fertile contro ls)		Catalase	Show abstract