Endometriosis Knowledgebase

Search Result

Gene id

85004

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

RERG Gene UCSC Ensembl

Gene name

RAS like estrogen regulated growth inhibitor

Alternate names

ras-related and estrogen-regulated growth inhibitor,

Gene location

12p12.3 (15221476: 15107781) Exons: 6 NC_000012.12

Gene summary(Entrez)

RERG, a member of the RAS superfamily of GTPases, inhibits cell proliferation and tumor formation (Finlin et al., 2001 [PubMed 11533059]).[supplied by OMIM, Mar 2009]

OMIM

612664

Protein Summary

Protein general information

Q96A58

Name: Ras-related and estrogen-regulated growth inhibitor

Length: 199 Mass: 22,608

Tissue specificity: Detected in heart, brain, placenta, lung, liver, skin, kidney and pancreas. Detected in estrogen receptor-positive breast-derived cell lines, but not in estrogen receptor-negative cell lines. Expression is decreased or lost in a signif

Sequence

MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQREGHMR
WGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATELACAFYECSAC
TGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS

Structural information

Interpro:	IPR027417 IPR005225 IPR001806 IPR020849
Prosite:	PS51421
Pfam:	PF00071
PDB:	2ATV
PDBsum:	2ATV
STRING:	ENSP00000256953;

Other Databases

GeneCards: RERG; Malacards: RERG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IDA	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0007264	small GTPase mediated sig nal transduction	NAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009725	response to hormone	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0019003	GDP binding	TAS	molecular_function
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030331	estrogen receptor binding	NAS	molecular_function
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0003924	GTPase activity	IDA	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0007165	signal transduction	IEA	biological_process
GO:0007264	small GTPase mediated sig nal transduction	IEA	biological_process
GO:0007264	small GTPase mediated sig nal transduction	NAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009725	response to hormone	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0019003	GDP binding	TAS	molecular_function
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030331	estrogen receptor binding	NAS	molecular_function
GO:0003924	GTPase activity	IDA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0007264	small GTPase mediated sig nal transduction	NAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009725	response to hormone	IDA	biological_process
GO:0019003	GDP binding	TAS	molecular_function
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030331	estrogen receptor binding	NAS	molecular_function

Diseases

Associated diseases	References
Lung cancer	GAD18676680
Chronic obstructive pulmonary disease (COPD)	GAD19625176
Bladder cancer	GAD19692168
Endometriosis	PubMed24992181

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24992181	Endometrio sis					ESR2	Show abstract