Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 85004
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol RERG   Gene   UCSC   Ensembl
Gene name RAS like estrogen regulated growth inhibitor
Alternate names ras-related and estrogen-regulated growth inhibitor,
Gene location 12p12.3 (15221476: 15107781)     Exons: 6     NC_000012.12
Gene summary(Entrez) RERG, a member of the RAS superfamily of GTPases, inhibits cell proliferation and tumor formation (Finlin et al., 2001 [PubMed 11533059]).[supplied by OMIM, Mar 2009]
OMIM 612664

Protein Summary

Protein general information Q96A58  

Name: Ras-related and estrogen-regulated growth inhibitor

Length: 199  Mass: 22,608

Tissue specificity: Detected in heart, brain, placenta, lung, liver, skin, kidney and pancreas. Detected in estrogen receptor-positive breast-derived cell lines, but not in estrogen receptor-negative cell lines. Expression is decreased or lost in a signif

Sequence MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQREGHMR
WGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATELACAFYECSAC
TGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS
Structural information
Interpro:  IPR027417 IPR005225 IPR001806 IPR020849
Prosite:   PS51421

Pfam:  
PF00071

PDB:  
2ATV
PDBsum:   2ATV
STRING:   ENSP00000256953;
Other Databases GeneCards:  RERG;  Malacards:  RERG

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0003924 GTPase activity
IDA molecular_function
GO:0005525 GTP binding
IEA molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0007264 small GTPase mediated sig
nal transduction
NAS biological_process
GO:0008285 negative regulation of ce
ll proliferation
IDA biological_process
GO:0009725 response to hormone
IDA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0019003 GDP binding
TAS molecular_function
GO:0030308 negative regulation of ce
ll growth
IDA biological_process
GO:0030331 estrogen receptor binding
NAS molecular_function
GO:0000166 nucleotide binding
IEA molecular_function
GO:0003924 GTPase activity
IDA molecular_function
GO:0005525 GTP binding
IEA molecular_function
GO:0005525 GTP binding
IEA molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0007165 signal transduction
IEA biological_process
GO:0007264 small GTPase mediated sig
nal transduction
IEA biological_process
GO:0007264 small GTPase mediated sig
nal transduction
NAS biological_process
GO:0008285 negative regulation of ce
ll proliferation
IDA biological_process
GO:0009725 response to hormone
IDA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0019003 GDP binding
TAS molecular_function
GO:0030308 negative regulation of ce
ll growth
IDA biological_process
GO:0030331 estrogen receptor binding
NAS molecular_function
GO:0003924 GTPase activity
IDA molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0007264 small GTPase mediated sig
nal transduction
NAS biological_process
GO:0008285 negative regulation of ce
ll proliferation
IDA biological_process
GO:0009725 response to hormone
IDA biological_process
GO:0019003 GDP binding
TAS molecular_function
GO:0030308 negative regulation of ce
ll growth
IDA biological_process
GO:0030331 estrogen receptor binding
NAS molecular_function

Diseases

Associated diseases References
Lung cancer GAD18676680
Chronic obstructive pulmonary disease (COPD) GAD19625176
Bladder cancer GAD19692168
Endometriosis PubMed24992181

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
24992181 Endometrio
sis


ESR2
Show abstract