Search Result
| Gene id | 85480 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | TSLP Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Gene name | thymic stromal lymphopoietin | ||||||||||||||||||||||||||||||||||||
| Alternate names | thymic stromal lymphopoietin, | ||||||||||||||||||||||||||||||||||||
| Gene location |
5q22.1 (111070079: 111078023) Exons: 6 NC_000005.10 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012] |
||||||||||||||||||||||||||||||||||||
| OMIM | 607003 | ||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | Q969D9 Name: Thymic stromal lymphopoietin Length: 159 Mass: 18,141 Tissue specificity: Isoform 1 is expressed in a number of tissues including heart, liver and prostate. Isoform 2 is the predominant form in keratinocytes of oral mucosa, skin and in salivary glands. It is secreted into saliva. {ECO | ||||||||||||||||||||||||||||||||||||
| Sequence |
MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHC LTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRR FNRPLLKQQ | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: TSLP; Malacards: TSLP | ||||||||||||||||||||||||||||||||||||
Gene ontology |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
KEGG pathways
|
|||||||||||||||||||||||||||||||||||||
|
hsa04060 Cytokine-cytokine receptor interaction hsa04630 Jak-STAT signaling pathway | |||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references |
|||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||