Endometriosis Knowledgebase

Search Result

Gene id

8549

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

LGR5 Gene UCSC Ensembl

Aliases

FEX, GPR49, GPR67, GRP49, HG38

Gene name

leucine rich repeat containing G protein-coupled receptor 5

Alternate names

leucine-rich repeat-containing G-protein coupled receptor 5, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38, orphan G protein-coupled receptor HG38,

Gene location

12q21.1 (71439769: 71586309) Exons: 19 NC_000012.12

Gene summary(Entrez)

The protein encoded by this gene is a leucine-rich repeat-containing receptor (LGR) and member of the G protein-coupled, 7-transmembrane receptor (GPCR) superfamily. The encoded protein is a receptor for R-spondins and is involved in the canonical Wnt signaling pathway. This protein plays a role in the formation and maintenance of adult intestinal stem cells during postembryonic development. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

OMIM

606667

Protein Summary

Protein general information

O75473

Name: Leucine-rich repeat-containing G-protein coupled receptor 5 (G-protein coupled receptor 49) (G-protein coupled receptor 67) (G-protein coupled receptor HG38)

Length: 907 Mass: 99,998

Tissue specificity: Expressed in skeletal muscle, placenta, spinal cord, and various region of brain. Expressed at the base of crypts in colonic and small mucosa stem cells. In premalignant cancer expression is not restricted to the cript base. Overexpres

Sequence

MDTSRLGVLLSLPVLLQLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSM
NNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHI
SYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSL
GKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA
FQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLSYNLLEDLPSFSVCQK
LQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKL
TGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDF
LLDFEEDLKALHSVQCSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTSTVFRSPLYISPIKLLIGVIA
AVNMLTGVSSAVLAGVDAFTFGSFARHGAWWENGVGCHVIGFLSIFASESSVFLLTLAALERGFSVKYSAKFETK
APFSSLKVIILLCALLALTMAAVPLLGGSKYGASPLCLPLPFGEPSTMGYMVALILLNSLCFLMMTIAYTKLYCN
LDKGDLENIWDCSMVKHIALLLFTNCILNCPVAFLSFSSLINLTFISPEVIKFILLVVVPLPACLNPLLYILFNP
HFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSS
VAFVPCL

Structural information

Protein Domains	LRRNT. (25-66)
Interpro:	IPR000276 IPR017452 IPR002131 IPR001611 IPR003591 IPR032675 IPR000372
Prosite:	PS50262 PS51450
Pfam:	PF00560 PF13855 PF01462
PDB:	4BSR 4BSS 4BST 4BSU 4KNG 4UFR 4UFS
PDBsum:	4BSR 4BSS 4BST 4BSU 4KNG 4UFR 4UFS
STRING:	ENSP00000266674;

Other Databases

GeneCards: LGR5; Malacards: LGR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001942	hair follicle development	IEA	biological_process
GO:0004888	transmembrane signaling r eceptor activity	IDA	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0009994	oocyte differentiation	IEA	biological_process
GO:0032588	trans-Golgi network membr ane	IDA	cellular_component
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0048839	inner ear development	IEA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:2001013	epithelial cell prolifera tion involved in renal tu bule morphogenesis	IEA	biological_process
GO:0004930	G-protein coupled recepto r activity	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IDA	molecular_function
GO:0001942	hair follicle development	IEA	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	IEA	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	IDA	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0009994	oocyte differentiation	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0032588	trans-Golgi network membr ane	IDA	cellular_component
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0048839	inner ear development	IEA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:2001013	epithelial cell prolifera tion involved in renal tu bule morphogenesis	IEA	biological_process
GO:0004930	G-protein coupled recepto r activity	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IDA	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	IDA	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0032588	trans-Golgi network membr ane	IDA	cellular_component
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IDA	biological_process
GO:0004930	G-protein coupled recepto r activity	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IDA	molecular_function

Diseases

Associated diseases	References
Endometriosis	INFBASE28923287

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28923287	Endometrio sis			51 (12 healthy women, 39 endom etrial women)			Show abstract