Endometriosis Knowledgebase

Search Result

Gene id

8626

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TP63 Gene UCSC Ensembl

Aliases

AIS, B(p51A), B(p51B), EEC3, KET, LMS, NBP, OFC8, RHS, SHFM4, TP53CP, TP53L, TP73L, p40, p51, p53CP, p63, p73H, p73L

Gene name

tumor protein p63

Alternate names

tumor protein 63, amplified in squamous cell carcinoma, chronic ulcerative stomatitis protein, keratinocyte transcription factor KET, transformation-related protein 63, tumor protein p53-competing protein,

Gene location

3q28 (189597114: 189897278) Exons: 19 NC_000003.12

Gene summary(Entrez)

This gene encodes a member of the p53 family of transcription factors. The functional domains of p53 family proteins include an N-terminal transactivation domain, a central DNA-binding domain and an oligomerization domain. Alternative splicing of this gene and the use of alternative promoters results in multiple transcript variants encoding different isoforms that vary in their functional properties. These isoforms function during skin development and maintenance, adult stem/progenitor cell regulation, heart development and premature aging. Some isoforms have been found to protect the germline by eliminating oocytes or testicular germ cells that have suffered DNA damage. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3); split-hand/foot malformation 4 (SHFM4); ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth); limb-mammary syndrome; Rap-Hodgkin syndrome (RHS); and orofacial cleft 8. [provided by RefSeq, Aug 2016]

OMIM

603273

Protein Summary

Protein general information

Q9H3D4

Name: Tumor protein 63 (p63) (Chronic ulcerative stomatitis protein) (CUSP) (Keratinocyte transcription factor KET) (Transformation related protein 63) (TP63) (Tumor protein p73 like) (p73L) (p40) (p51)

Length: 680 Mass: 76,785

Tissue specificity: Widely expressed, notably in heart, kidney, placenta, prostate, skeletal muscle, testis and thymus, although the precise isoform varies according to tissue type. Progenitor cell layers of skin, breast, eye and prostate express high lev

Sequence

MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLN
FVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYA
QPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVI
RAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTK
RPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQ
TSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQAL
PPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRI
KEEGE

Structural information

Protein Domains	SAM. (541-607)
Interpro:	IPR008967 IPR012346 IPR011615 IPR010991 IPR002117 IPR001660 IPR013761 IPR032645
Prosite:	PS00348
Pfam:	PF00870 PF07710 PF07647
CDD:	cd08367
PDB:	1RG6 2NB1 2RMN 2Y9T 2Y9U 3QYM 3QYN 3US0 3US1 3US2 3ZY0 3ZY1 4A9Z
PDBsum:	1RG6 2NB1 2RMN 2Y9T 2Y9U 3QYM 3QYN 3US0 3US1 3US2 3ZY0 3ZY1 4A9Z
DIP:	29588
MINT:	190238
STRING:	ENSP00000264731;

Other Databases

GeneCards: TP63; Malacards: TP63

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IBA	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000989	transcription factor acti vity, transcription facto r binding	IEA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001302	replicative cell aging	IEA	biological_process
GO:0001501	skeletal system developme nt	IEA	biological_process
GO:0001736	establishment of planar p olarity	IEA	biological_process
GO:0002039	p53 binding	IBA	molecular_function
GO:0002053	positive regulation of me senchymal cell proliferat ion	IEA	biological_process
GO:0002064	epithelial cell developme nt	IEA	biological_process
GO:0003677	DNA binding	NAS	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003684	damaged DNA binding	IBA	molecular_function
GO:0003690	double-stranded DNA bindi ng	IBA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	NAS	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IBA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005791	rough endoplasmic reticul um	IEA	cellular_component
GO:0005829	cytosol	IBA	cellular_component
GO:0006338	chromatin remodeling	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0006978	DNA damage response, sign al transduction by p53 cl ass mediator resulting in transcription of p21 cla ss mediator	IBA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0007499	ectoderm and mesoderm int eraction	IEA	biological_process
GO:0009954	proximal/distal pattern f ormation	IEA	biological_process
GO:0010165	response to X-ray	IBA	biological_process
GO:0010259	multicellular organism ag ing	IEA	biological_process
GO:0010332	response to gamma radiati on	IBA	biological_process
GO:0010481	epidermal cell division	IEA	biological_process
GO:0010482	regulation of epidermal c ell division	ISS	biological_process
GO:0010838	positive regulation of ke ratinocyte proliferation	IEA	biological_process
GO:0030216	keratinocyte differentiat ion	IEA	biological_process
GO:0030326	embryonic limb morphogene sis	IEA	biological_process
GO:0030425	dendrite	IBA	cellular_component
GO:0030859	polarized epithelial cell differentiation	IEA	biological_process
GO:0031069	hair follicle morphogenes is	IEA	biological_process
GO:0031571	mitotic G1 DNA damage che ckpoint	IBA	biological_process
GO:0034644	cellular response to UV	IBA	biological_process
GO:0036342	post-anal tail morphogene sis	IEA	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0042771	intrinsic apoptotic signa ling pathway in response to DNA damage by p53 clas s mediator	IBA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IBA	biological_process
GO:0043281	regulation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IEA	biological_process
GO:0043523	regulation of neuron apop totic process	IBA	biological_process
GO:0043565	sequence-specific DNA bin ding	IBA	molecular_function
GO:0043589	skin morphogenesis	IEA	biological_process
GO:0043616	keratinocyte proliferatio n	IEA	biological_process
GO:0044212	transcription regulatory region DNA binding	IEA	molecular_function
GO:0045617	negative regulation of ke ratinocyte differentiatio n	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IMP	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048485	sympathetic nervous syste m development	IEA	biological_process
GO:0048745	smooth muscle tissue deve lopment	IEA	biological_process
GO:0048807	female genitalia morphoge nesis	IEA	biological_process
GO:0050699	WW domain binding	IPI	molecular_function
GO:0051289	protein homotetramerizati on	IPI	biological_process
GO:0051402	neuron apoptotic process	IEA	biological_process
GO:0060157	urinary bladder developme nt	IEA	biological_process
GO:0060197	cloacal septation	IEA	biological_process
GO:0060513	prostatic bud formation	IEA	biological_process
GO:0060529	squamous basal epithelial stem cell differentiatio n involved in prostate gl and acinus development	IEA	biological_process
GO:0061436	establishment of skin bar rier	ISS	biological_process
GO:1900740	positive regulation of pr otein insertion into mito chondrial membrane involv ed in apoptotic signaling pathway	TAS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1902808	positive regulation of ce ll cycle G1/S phase trans ition	IMP	biological_process
GO:2000271	positive regulation of fi broblast apoptotic proces s	IDA	biological_process
GO:2000381	negative regulation of me soderm development	IEA	biological_process
GO:2000773	negative regulation of ce llular senescence	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IBA	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000989	transcription factor acti vity, transcription facto r binding	IEA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001302	replicative cell aging	IEA	biological_process
GO:0001501	skeletal system developme nt	IEA	biological_process
GO:0001736	establishment of planar p olarity	IEA	biological_process
GO:0001738	morphogenesis of a polari zed epithelium	IEA	biological_process
GO:0001942	hair follicle development	IEA	biological_process
GO:0002039	p53 binding	IBA	molecular_function
GO:0002053	positive regulation of me senchymal cell proliferat ion	IEA	biological_process
GO:0002064	epithelial cell developme nt	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	NAS	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003684	damaged DNA binding	IEA	molecular_function
GO:0003684	damaged DNA binding	IBA	molecular_function
GO:0003690	double-stranded DNA bindi ng	IEA	molecular_function
GO:0003690	double-stranded DNA bindi ng	IBA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	NAS	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IBA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005791	rough endoplasmic reticul um	IEA	cellular_component
GO:0005829	cytosol	IBA	cellular_component
GO:0006338	chromatin remodeling	IEA	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0006978	DNA damage response, sign al transduction by p53 cl ass mediator resulting in transcription of p21 cla ss mediator	IBA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0007389	pattern specification pro cess	IEA	biological_process
GO:0007499	ectoderm and mesoderm int eraction	IEA	biological_process
GO:0007569	cell aging	IEA	biological_process
GO:0008544	epidermis development	IEA	biological_process
GO:0009887	animal organ morphogenesi s	IEA	biological_process
GO:0009954	proximal/distal pattern f ormation	IEA	biological_process
GO:0010165	response to X-ray	IBA	biological_process
GO:0010259	multicellular organism ag ing	IEA	biological_process
GO:0010332	response to gamma radiati on	IBA	biological_process
GO:0010481	epidermal cell division	IEA	biological_process
GO:0010482	regulation of epidermal c ell division	IEA	biological_process
GO:0010482	regulation of epidermal c ell division	ISS	biological_process
GO:0010838	positive regulation of ke ratinocyte proliferation	IEA	biological_process
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0030154	cell differentiation	IEA	biological_process
GO:0030216	keratinocyte differentiat ion	IEA	biological_process
GO:0030326	embryonic limb morphogene sis	IEA	biological_process
GO:0030425	dendrite	IEA	cellular_component
GO:0030425	dendrite	IBA	cellular_component
GO:0030850	prostate gland developmen t	IEA	biological_process
GO:0030855	epithelial cell different iation	IEA	biological_process
GO:0030859	polarized epithelial cell differentiation	IEA	biological_process
GO:0031069	hair follicle morphogenes is	IEA	biological_process
GO:0031571	mitotic G1 DNA damage che ckpoint	IBA	biological_process
GO:0032502	developmental process	IEA	biological_process
GO:0034644	cellular response to UV	IBA	biological_process
GO:0036342	post-anal tail morphogene sis	IEA	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0042771	intrinsic apoptotic signa ling pathway in response to DNA damage by p53 clas s mediator	IEA	biological_process
GO:0042771	intrinsic apoptotic signa ling pathway in response to DNA damage by p53 clas s mediator	IBA	biological_process
GO:0042802	identical protein binding	IEA	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IBA	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0043281	regulation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IEA	biological_process
GO:0043523	regulation of neuron apop totic process	IBA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IBA	molecular_function
GO:0043589	skin morphogenesis	IEA	biological_process
GO:0043616	keratinocyte proliferatio n	IEA	biological_process
GO:0044212	transcription regulatory region DNA binding	IEA	molecular_function
GO:0045617	negative regulation of ke ratinocyte differentiatio n	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IMP	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IEA	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048485	sympathetic nervous syste m development	IEA	biological_process
GO:0048646	anatomical structure form ation involved in morphog enesis	IEA	biological_process
GO:0048745	smooth muscle tissue deve lopment	IEA	biological_process
GO:0048807	female genitalia morphoge nesis	IEA	biological_process
GO:0050699	WW domain binding	IPI	molecular_function
GO:0051262	protein tetramerization	IEA	biological_process
GO:0051289	protein homotetramerizati on	IPI	biological_process
GO:0051402	neuron apoptotic process	IEA	biological_process
GO:0060157	urinary bladder developme nt	IEA	biological_process
GO:0060197	cloacal septation	IEA	biological_process
GO:0060513	prostatic bud formation	IEA	biological_process
GO:0060529	squamous basal epithelial stem cell differentiatio n involved in prostate gl and acinus development	IEA	biological_process
GO:0061436	establishment of skin bar rier	IEA	biological_process
GO:0061436	establishment of skin bar rier	ISS	biological_process
GO:1900740	positive regulation of pr otein insertion into mito chondrial membrane involv ed in apoptotic signaling pathway	TAS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1902808	positive regulation of ce ll cycle G1/S phase trans ition	IMP	biological_process
GO:2000271	positive regulation of fi broblast apoptotic proces s	IDA	biological_process
GO:2000381	negative regulation of me soderm development	IEA	biological_process
GO:2000773	negative regulation of ce llular senescence	IMP	biological_process
GO:2001235	positive regulation of ap optotic signaling pathway	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IBA	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0002039	p53 binding	IBA	molecular_function
GO:0003677	DNA binding	NAS	molecular_function
GO:0003682	chromatin binding	IDA	molecular_function
GO:0003684	damaged DNA binding	IBA	molecular_function
GO:0003690	double-stranded DNA bindi ng	IBA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	NAS	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IBA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IBA	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0006978	DNA damage response, sign al transduction by p53 cl ass mediator resulting in transcription of p21 cla ss mediator	IBA	biological_process
GO:0010165	response to X-ray	IBA	biological_process
GO:0010332	response to gamma radiati on	IBA	biological_process
GO:0010482	regulation of epidermal c ell division	ISS	biological_process
GO:0030425	dendrite	IBA	cellular_component
GO:0031571	mitotic G1 DNA damage che ckpoint	IBA	biological_process
GO:0034644	cellular response to UV	IBA	biological_process
GO:0042771	intrinsic apoptotic signa ling pathway in response to DNA damage by p53 clas s mediator	IBA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IBA	biological_process
GO:0043523	regulation of neuron apop totic process	IBA	biological_process
GO:0043565	sequence-specific DNA bin ding	IBA	molecular_function
GO:0045669	positive regulation of os teoblast differentiation	IMP	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0050699	WW domain binding	IPI	molecular_function
GO:0051289	protein homotetramerizati on	IPI	biological_process
GO:0061436	establishment of skin bar rier	ISS	biological_process
GO:1900740	positive regulation of pr otein insertion into mito chondrial membrane involv ed in apoptotic signaling pathway	TAS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1902808	positive regulation of ce ll cycle G1/S phase trans ition	IMP	biological_process
GO:2000271	positive regulation of fi broblast apoptotic proces s	IDA	biological_process
GO:2000773	negative regulation of ce llular senescence	IMP	biological_process

KEGG pathways

hsa05206 MicroRNAs in cancer

Diseases

Associated diseases	References
ADULT syndrome	KEGG: H00641, OMIM: 603273
Ankyloblepharon-ctodermal defects-cleft lip/palate	KEGG: H00752, OMIM: 603273, KEGG: H00638
Cancer	PMID: 18676680
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Endometrial cancer	PMID: 25354862
Endometrial polyp	PMID: 25354862
Endometriosis	PMID: 9506747
Hay-Wells syndrome	OMIM: 603273
Isolated orofacial clefts	KEGG: H00516, OMIM: 603273
Limb-mammary syndrome	KEGG: H00640, OMIM: 603273
Endometriosis	INFBASE17616998
Rapp-Hodgkin syndrome	OMIM: 603273
Recurrent miscarriage	PMID: 25218545
Split-hand/foot malformation	KEGG: H00471, OMIM: 603273

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17616998	Endometrio sis			83 (15 peritone al endometriosi s specimens, 22 endometrioma s pecimens, 36 ad enomyosis speci mens, 10 rectov aginal septum/a bdominal wall s pecimens)		p63	Show abstract