Endometriosis Knowledgebase

Search Result

Gene id

8660

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IRS2 Gene UCSC Ensembl

Aliases

IRS-2

Gene name

insulin receptor substrate 2

Alternate names

insulin receptor substrate 2,

Gene location

13q34 (109786566: 109753836) Exons: 2 NC_000013.11

Gene summary(Entrez)

This gene encodes the insulin receptor substrate 2, a cytoplasmic signaling molecule that mediates effects of insulin, insulin-like growth factor 1, and other cytokines by acting as a molecular adaptor between diverse receptor tyrosine kinases and downstream effectors. The product of this gene is phosphorylated by the insulin receptor tyrosine kinase upon receptor stimulation, as well as by an interleukin 4 receptor-associated kinase in response to IL4 treatment. [provided by RefSeq, Jul 2008]

OMIM

600797

Protein Summary

Protein general information

Q9Y4H2

Name: Insulin receptor substrate 2 (IRS 2)

Length: 1338 Mass: 137,334

Sequence

MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEATAGGGSAPQPPRLEY
YESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDEYFAVAAENEQEQEGWYRALTDLVSEGRAAA
GDAPPAAAPAASCSASLPGALGGSAGAAGAEDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSART
IGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEF
RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCRVRTASEGDGGAAAGA
AAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLPAGGALQHSRSMSMPVAHSPPAATSPGSLSS
SSGHGSGSYPPPPGPHPPLPHPLHHGPGQRPSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIA
ETPPARDGGGGGEFYGYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTL
MRATFSGSAGRLCPSCPASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGAALAGSGSGSCRSDDY
MPMSPASVSAPKQILQPRAAAAAAAAVPSAGPAGPAPTSAAGRTFPASGGGYKASSPAESSPEDSGYMRMWCGSK
LSMEHADGKLLPNGDYLNVSPSDAVTTGTPPDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVL
MSSPVGRILEEERLEPQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPS
LPSMHEYPLPPEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGSGTPGTSSDSRQRSPL
SDYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPRPSASPSSSLQPPPPPPAPGELYRLPPASAV
ATAQGPGAASSLSSDTGDNGDYTEMAFGVAATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQASQ
PPDPHRGAKVIRADPQGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGGGDEP
PTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVREEPGLPPQPQPPPPPL
PQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTYASIDFLSHHLKEATIVKE

Structural information

Protein Domains	PH. (16-144) IRS-type (194-298)
Motifs	YXXM motif(540-543) YXXM motif(598-601) YXXM motif(653-656) YXXM motif(675-678) YXXM motif(742-745) YXXM motif(823-826) YXXM motif(1072-1075)
Interpro:	IPR002404 IPR011993 IPR001849
Prosite:	PS51064 PS50003
Pfam:	PF02174 PF00169
CDD:	cd01204
PDB:	3FQW 3FQX
PDBsum:	3FQW 3FQX
MINT:	156306
STRING:	ENSP00000365016;

Other Databases

GeneCards: IRS2; Malacards: IRS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0002053	positive regulation of me senchymal cell proliferat ion	IEA	biological_process
GO:0002903	negative regulation of B cell apoptotic process	ISS	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005158	insulin receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005829	cytosol	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006006	glucose metabolic process	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0008283	cell proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	NAS	biological_process
GO:0008286	insulin receptor signalin g pathway	ISS	biological_process
GO:0008286	insulin receptor signalin g pathway	IBA	biological_process
GO:0009749	response to glucose	ISS	biological_process
GO:0010748	negative regulation of pl asma membrane long-chain fatty acid transport	IMP	biological_process
GO:0010907	positive regulation of gl ucose metabolic process	IMP	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0019216	regulation of lipid metab olic process	TAS	biological_process
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019903	protein phosphatase bindi ng	IEA	molecular_function
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030879	mammary gland development	IEA	biological_process
GO:0030890	positive regulation of B cell proliferation	ISS	biological_process
GO:0032000	positive regulation of fa tty acid beta-oxidation	IMP	biological_process
GO:0032024	positive regulation of in sulin secretion	ISS	biological_process
GO:0032869	cellular response to insu lin stimulus	IMP	biological_process
GO:0033673	negative regulation of ki nase activity	ISS	biological_process
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043548	phosphatidylinositol 3-ki nase binding	IBA	molecular_function
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	IMP	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	NAS	biological_process
GO:0046326	positive regulation of gl ucose import	IMP	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IEA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0055088	lipid homeostasis	TAS	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071889	14-3-3 protein binding	IEA	molecular_function
GO:0000165	MAPK cascade	TAS	biological_process
GO:0002053	positive regulation of me senchymal cell proliferat ion	IEA	biological_process
GO:0002903	negative regulation of B cell apoptotic process	IEA	biological_process
GO:0002903	negative regulation of B cell apoptotic process	ISS	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005158	insulin receptor binding	IEA	molecular_function
GO:0005158	insulin receptor binding	IEA	molecular_function
GO:0005158	insulin receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	IBA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006006	glucose metabolic process	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0008283	cell proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	NAS	biological_process
GO:0008286	insulin receptor signalin g pathway	IEA	biological_process
GO:0008286	insulin receptor signalin g pathway	ISS	biological_process
GO:0008286	insulin receptor signalin g pathway	IBA	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0009749	response to glucose	ISS	biological_process
GO:0010748	negative regulation of pl asma membrane long-chain fatty acid transport	IMP	biological_process
GO:0010907	positive regulation of gl ucose metabolic process	IMP	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0019216	regulation of lipid metab olic process	TAS	biological_process
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019903	protein phosphatase bindi ng	IEA	molecular_function
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030879	mammary gland development	IEA	biological_process
GO:0030890	positive regulation of B cell proliferation	IEA	biological_process
GO:0030890	positive regulation of B cell proliferation	ISS	biological_process
GO:0032000	positive regulation of fa tty acid beta-oxidation	IMP	biological_process
GO:0032024	positive regulation of in sulin secretion	IEA	biological_process
GO:0032024	positive regulation of in sulin secretion	ISS	biological_process
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	IMP	biological_process
GO:0033673	negative regulation of ki nase activity	IEA	biological_process
GO:0033673	negative regulation of ki nase activity	ISS	biological_process
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043548	phosphatidylinositol 3-ki nase binding	IEA	molecular_function
GO:0043548	phosphatidylinositol 3-ki nase binding	IBA	molecular_function
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	IMP	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	NAS	biological_process
GO:0046326	positive regulation of gl ucose import	IMP	biological_process
GO:0046854	phosphatidylinositol phos phorylation	IEA	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0055088	lipid homeostasis	TAS	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071889	14-3-3 protein binding	IEA	molecular_function
GO:1901653	cellular response to pept ide	IEA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0002903	negative regulation of B cell apoptotic process	ISS	biological_process
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005158	insulin receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005829	cytosol	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006006	glucose metabolic process	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	NAS	biological_process
GO:0008286	insulin receptor signalin g pathway	ISS	biological_process
GO:0008286	insulin receptor signalin g pathway	IBA	biological_process
GO:0009749	response to glucose	ISS	biological_process
GO:0010748	negative regulation of pl asma membrane long-chain fatty acid transport	IMP	biological_process
GO:0010907	positive regulation of gl ucose metabolic process	IMP	biological_process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological_process
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular_function
GO:0019216	regulation of lipid metab olic process	TAS	biological_process
GO:0030890	positive regulation of B cell proliferation	ISS	biological_process
GO:0032000	positive regulation of fa tty acid beta-oxidation	IMP	biological_process
GO:0032024	positive regulation of in sulin secretion	ISS	biological_process
GO:0032869	cellular response to insu lin stimulus	IMP	biological_process
GO:0033673	negative regulation of ki nase activity	ISS	biological_process
GO:0043548	phosphatidylinositol 3-ki nase binding	IBA	molecular_function
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	IMP	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	NAS	biological_process
GO:0046326	positive regulation of gl ucose import	IMP	biological_process
GO:0046934	phosphatidylinositol-4,5- bisphosphate 3-kinase act ivity	TAS	molecular_function
GO:0048015	phosphatidylinositol-medi ated signaling	TAS	biological_process
GO:0055088	lipid homeostasis	TAS	biological_process

KEGG pathways

hsa05206  MicroRNAs in cancer
hsa04068  FoxO signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04931  Insulin resistance
hsa04211  Longevity regulating pathway
hsa04140  Autophagy - animal
hsa04920  Adipocytokine signaling pathway
hsa04213  Longevity regulating pathway
hsa04022  cGMP-PKG signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04930  Type II diabetes mellitus

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Asthma	PMID: 19604268
Atherosclerosis	PMID: 18506362
Diabetes	OMIM: 600797
Diminished ovarian reserve (DOR)	PMID: 22906700, 22246450
Endometrial cancer	PMID: 20184486
Endometriosis	PMID: 19878940
Inflammatory bowel disease	PMID: 17068223
Obesity	PMID: 12687350
Polycystic ovary syndrome (PCOS)	PMID: 12213887
Polycystic ovary syndrome (PCOS)	PMID: 15926113
Endometriosis	INFBASE19878940

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19878940	Endometrio sis	IRS2 (G1057D)		270 (135 women with endometrio sis (63 women i n stages I-II e ndometriosis, 7 2 women in stag es III-IV), 135 women without endometriosis)		IRS2	Show abstract