Endometriosis Knowledgebase

Search Result

Gene id

8829

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NRP1 Gene UCSC Ensembl

Aliases

BDCA4, CD304, NP1, NRP, VEGF165R

Gene name

neuropilin 1

Alternate names

neuropilin-1, transmembrane receptor, vascular endothelial cell growth factor 165 receptor,

Gene location

10p11.22 (33334904: 33177490) Exons: 18 NC_000010.11

Gene summary(Entrez)

This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. Several alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

OMIM

602069

Protein Summary

Protein general information

O14786

Name: Neuropilin 1 (Vascular endothelial cell growth factor 165 receptor) (CD antigen CD304)

Length: 923 Mass: 103,134

Tissue specificity: The expression of isoforms 1 and 2 does not seem to overlap. Isoform 1 is expressed by the blood vessels of different tissues. In the developing embryo it is found predominantly in the nervous system. In adult tissues, it is highly exp

Sequence

MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHF
DLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQN
YTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIG
RYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEG
NKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSS
NQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSD
WKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLV
DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDNHVQLKWSV
LTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQ
LVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKID
ETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYN
FELVDGVKLKKDKLNTQSTYSEA

Structural information

Protein Domains	CUB (27-141) CUB (147-265) F5/8 (275-424) F5/8 (431-583)
Interpro:	IPR013320 IPR000859 IPR000421 IPR008979 IPR000998 IPR014648 IPR022579 IPR027146
Prosite:	PS01180 PS01285 PS01286 PS50022 PS00740 PS50060
Pfam:	PF00431 PF11980 PF00754 PF00629
CDD:	cd00041 cd06263
PDB:	1KEX 2QQI 2QQM 2QQN 3I97 4DEQ 4RN5 5C7G 5IJR 5L73
PDBsum:	1KEX 2QQI 2QQM 2QQN 3I97 4DEQ 4RN5 5C7G 5IJR 5L73
DIP:	5743
MINT:	2834207
STRING:	ENSP00000265371;

Other Databases

GeneCards: NRP1; Malacards: NRP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IMP	biological_process
GO:0001525	angiogenesis	ISS	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	ISS	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	ISS	biological_process
GO:0001764	neuron migration	ISS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	TAS	biological_process
GO:0002040	sprouting angiogenesis	ISS	biological_process
GO:0002042	cell migration involved i n sprouting angiogenesis	ISS	biological_process
GO:0002116	semaphorin receptor compl ex	NAS	cellular_component
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	ISS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005769	early endosome	ISS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005883	neurofilament	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007411	axon guidance	NAS	biological_process
GO:0007413	axonal fasciculation	IEA	biological_process
GO:0008201	heparin binding	IEA	molecular_function
GO:0009611	response to wounding	IEA	biological_process
GO:0009887	animal organ morphogenesi s	TAS	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	TAS	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	TAS	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016358	dendrite development	IEA	biological_process
GO:0017154	semaphorin receptor activ ity	NAS	molecular_function
GO:0019838	growth factor binding	TAS	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019955	cytokine binding	NAS	molecular_function
GO:0021612	facial nerve structural o rganization	IEA	biological_process
GO:0021637	trigeminal nerve structur al organization	IEA	biological_process
GO:0021649	vestibulocochlear nerve s tructural organization	IEA	biological_process
GO:0021675	nerve development	ISS	biological_process
GO:0021785	branchiomotor neuron axon guidance	IEA	biological_process
GO:0021828	gonadotrophin-releasing h ormone neuronal migration to the hypothalamus	IEA	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0030426	growth cone	IEA	cellular_component
GO:0031290	retinal ganglion cell axo n guidance	ISS	biological_process
GO:0031410	cytoplasmic vesicle	TAS	cellular_component
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IMP	biological_process
GO:0035767	endothelial cell chemotax is	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	ISS	biological_process
GO:0036486	ventral trunk neural cres t cell migration	IEA	biological_process
GO:0038085	vascular endothelial grow th factor binding	IPI	molecular_function
GO:0038190	VEGF-activated neuropilin signaling pathway	ISS	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043049	otic placode formation	IEA	biological_process
GO:0043235	receptor complex	TAS	cellular_component
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048008	platelet-derived growth f actor receptor signaling pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	IMP	biological_process
GO:0048842	positive regulation of ax on extension involved in axon guidance	ISS	biological_process
GO:0048843	negative regulation of ax on extension involved in axon guidance	IEA	biological_process
GO:0048844	artery morphogenesis	ISS	biological_process
GO:0048844	artery morphogenesis	ISS	biological_process
GO:0048846	axon extension involved i n axon guidance	ISS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IMP	biological_process
GO:0050918	positive chemotaxis	ISS	biological_process
GO:0060301	positive regulation of cy tokine activity	TAS	biological_process
GO:0060385	axonogenesis involved in innervation	ISS	biological_process
GO:0060627	regulation of vesicle-med iated transport	TAS	biological_process
GO:0060666	dichotomous subdivision o f terminal units involved in salivary gland branch ing	IEA	biological_process
GO:0060978	angiogenesis involved in coronary vascular morphog enesis	ISS	biological_process
GO:0060982	coronary artery morphogen esis	IEA	biological_process
GO:0061299	retina vasculature morpho genesis in camera-type ey e	ISS	biological_process
GO:0061441	renal artery morphogenesi s	IEA	biological_process
GO:0061549	sympathetic ganglion deve lopment	ISS	biological_process
GO:0061551	trigeminal ganglion devel opment	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0071526	semaphorin-plexin signali ng pathway	NAS	biological_process
GO:0071679	commissural neuron axon g uidance	ISS	biological_process
GO:0090259	regulation of retinal gan glion cell axon guidance	ISS	biological_process
GO:0097102	endothelial tip cell fate specification	ISS	biological_process
GO:0097374	sensory neuron axon guida nce	IEA	biological_process
GO:0097443	sorting endosome	ISS	cellular_component
GO:0097490	sympathetic neuron projec tion extension	ISS	biological_process
GO:0097491	sympathetic neuron projec tion guidance	ISS	biological_process
GO:1901166	neural crest cell migrati on involved in autonomic nervous system developmen t	ISS	biological_process
GO:1901998	toxin transport	IEA	biological_process
GO:1902285	semaphorin-plexin signali ng pathway involved in ne uron projection guidance	ISS	biological_process
GO:1902287	semaphorin-plexin signali ng pathway involved in ax on guidance	IEA	biological_process
GO:1902336	positive regulation of re tinal ganglion cell axon guidance	ISS	biological_process
GO:1902378	VEGF-activated neuropilin signaling pathway involv ed in axon guidance	IEA	biological_process
GO:1902946	protein localization to e arly endosome	ISS	biological_process
GO:1903375	facioacoustic ganglion de velopment	IEA	biological_process
GO:1904835	dorsal root ganglion morp hogenesis	IEA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	IMP	biological_process
GO:0001525	angiogenesis	ISS	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	IEA	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	ISS	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	ISS	biological_process
GO:0001764	neuron migration	IEA	biological_process
GO:0001764	neuron migration	ISS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	TAS	biological_process
GO:0002040	sprouting angiogenesis	IEA	biological_process
GO:0002040	sprouting angiogenesis	ISS	biological_process
GO:0002042	cell migration involved i n sprouting angiogenesis	IEA	biological_process
GO:0002042	cell migration involved i n sprouting angiogenesis	ISS	biological_process
GO:0002116	semaphorin receptor compl ex	NAS	cellular_component
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IEA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IEA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	ISS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	NAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005769	early endosome	ISS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005883	neurofilament	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007399	nervous system developmen t	IEA	biological_process
GO:0007411	axon guidance	IEA	biological_process
GO:0007411	axon guidance	IEA	biological_process
GO:0007411	axon guidance	NAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0007413	axonal fasciculation	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0008045	motor neuron axon guidanc e	IEA	biological_process
GO:0008201	heparin binding	IEA	molecular_function
GO:0009611	response to wounding	IEA	biological_process
GO:0009887	animal organ morphogenesi s	IEA	biological_process
GO:0009887	animal organ morphogenesi s	TAS	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	TAS	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	TAS	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016358	dendrite development	IEA	biological_process
GO:0016477	cell migration	IEA	biological_process
GO:0017154	semaphorin receptor activ ity	IEA	molecular_function
GO:0017154	semaphorin receptor activ ity	IEA	molecular_function
GO:0017154	semaphorin receptor activ ity	NAS	molecular_function
GO:0019838	growth factor binding	IEA	molecular_function
GO:0019838	growth factor binding	IEA	molecular_function
GO:0019838	growth factor binding	TAS	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019955	cytokine binding	NAS	molecular_function
GO:0021612	facial nerve structural o rganization	IEA	biological_process
GO:0021636	trigeminal nerve morphoge nesis	IEA	biological_process
GO:0021637	trigeminal nerve structur al organization	IEA	biological_process
GO:0021649	vestibulocochlear nerve s tructural organization	IEA	biological_process
GO:0021675	nerve development	IEA	biological_process
GO:0021675	nerve development	ISS	biological_process
GO:0021785	branchiomotor neuron axon guidance	IEA	biological_process
GO:0021828	gonadotrophin-releasing h ormone neuronal migration to the hypothalamus	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030424	axon	ISS	cellular_component
GO:0030426	growth cone	IEA	cellular_component
GO:0030517	negative regulation of ax on extension	IEA	biological_process
GO:0031290	retinal ganglion cell axo n guidance	IEA	biological_process
GO:0031290	retinal ganglion cell axo n guidance	ISS	biological_process
GO:0031410	cytoplasmic vesicle	TAS	cellular_component
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IMP	biological_process
GO:0035767	endothelial cell chemotax is	IEA	biological_process
GO:0035767	endothelial cell chemotax is	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IEA	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	ISS	biological_process
GO:0036486	ventral trunk neural cres t cell migration	IEA	biological_process
GO:0038084	vascular endothelial grow th factor signaling pathw ay	IEA	biological_process
GO:0038085	vascular endothelial grow th factor binding	IEA	molecular_function
GO:0038085	vascular endothelial grow th factor binding	IPI	molecular_function
GO:0038190	VEGF-activated neuropilin signaling pathway	IEA	biological_process
GO:0038190	VEGF-activated neuropilin signaling pathway	ISS	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043049	otic placode formation	IEA	biological_process
GO:0043235	receptor complex	TAS	cellular_component
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048008	platelet-derived growth f actor receptor signaling pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IEA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IEA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	IMP	biological_process
GO:0048485	sympathetic nervous syste m development	IEA	biological_process
GO:0048666	neuron development	IEA	biological_process
GO:0048841	regulation of axon extens ion involved in axon guid ance	IEA	biological_process
GO:0048842	positive regulation of ax on extension involved in axon guidance	IEA	biological_process
GO:0048842	positive regulation of ax on extension involved in axon guidance	ISS	biological_process
GO:0048843	negative regulation of ax on extension involved in axon guidance	IEA	biological_process
GO:0048844	artery morphogenesis	IEA	biological_process
GO:0048844	artery morphogenesis	ISS	biological_process
GO:0048844	artery morphogenesis	ISS	biological_process
GO:0048846	axon extension involved i n axon guidance	IEA	biological_process
GO:0048846	axon extension involved i n axon guidance	ISS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IMP	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0050918	positive chemotaxis	ISS	biological_process
GO:0060301	positive regulation of cy tokine activity	TAS	biological_process
GO:0060385	axonogenesis involved in innervation	IEA	biological_process
GO:0060385	axonogenesis involved in innervation	ISS	biological_process
GO:0060627	regulation of vesicle-med iated transport	TAS	biological_process
GO:0060666	dichotomous subdivision o f terminal units involved in salivary gland branch ing	IEA	biological_process
GO:0060978	angiogenesis involved in coronary vascular morphog enesis	IEA	biological_process
GO:0060978	angiogenesis involved in coronary vascular morphog enesis	ISS	biological_process
GO:0060982	coronary artery morphogen esis	IEA	biological_process
GO:0061299	retina vasculature morpho genesis in camera-type ey e	IEA	biological_process
GO:0061299	retina vasculature morpho genesis in camera-type ey e	ISS	biological_process
GO:0061441	renal artery morphogenesi s	IEA	biological_process
GO:0061549	sympathetic ganglion deve lopment	IEA	biological_process
GO:0061549	sympathetic ganglion deve lopment	ISS	biological_process
GO:0061551	trigeminal ganglion devel opment	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0071526	semaphorin-plexin signali ng pathway	IEA	biological_process
GO:0071526	semaphorin-plexin signali ng pathway	IEA	biological_process
GO:0071526	semaphorin-plexin signali ng pathway	NAS	biological_process
GO:0071679	commissural neuron axon g uidance	IEA	biological_process
GO:0071679	commissural neuron axon g uidance	ISS	biological_process
GO:0090259	regulation of retinal gan glion cell axon guidance	IEA	biological_process
GO:0090259	regulation of retinal gan glion cell axon guidance	ISS	biological_process
GO:0097102	endothelial tip cell fate specification	ISS	biological_process
GO:0097374	sensory neuron axon guida nce	IEA	biological_process
GO:0097443	sorting endosome	IEA	cellular_component
GO:0097443	sorting endosome	ISS	cellular_component
GO:0097490	sympathetic neuron projec tion extension	IEA	biological_process
GO:0097490	sympathetic neuron projec tion extension	ISS	biological_process
GO:0097491	sympathetic neuron projec tion guidance	IEA	biological_process
GO:0097491	sympathetic neuron projec tion guidance	ISS	biological_process
GO:1901166	neural crest cell migrati on involved in autonomic nervous system developmen t	IEA	biological_process
GO:1901166	neural crest cell migrati on involved in autonomic nervous system developmen t	ISS	biological_process
GO:1901998	toxin transport	IEA	biological_process
GO:1902285	semaphorin-plexin signali ng pathway involved in ne uron projection guidance	IEA	biological_process
GO:1902285	semaphorin-plexin signali ng pathway involved in ne uron projection guidance	ISS	biological_process
GO:1902287	semaphorin-plexin signali ng pathway involved in ax on guidance	IEA	biological_process
GO:1902336	positive regulation of re tinal ganglion cell axon guidance	IEA	biological_process
GO:1902336	positive regulation of re tinal ganglion cell axon guidance	ISS	biological_process
GO:1902378	VEGF-activated neuropilin signaling pathway involv ed in axon guidance	IEA	biological_process
GO:1902946	protein localization to e arly endosome	IEA	biological_process
GO:1902946	protein localization to e arly endosome	ISS	biological_process
GO:1903375	facioacoustic ganglion de velopment	IEA	biological_process
GO:1904835	dorsal root ganglion morp hogenesis	IEA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IEA	biological_process
GO:0001525	angiogenesis	IMP	biological_process
GO:0001525	angiogenesis	ISS	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	ISS	biological_process
GO:0001569	branching involved in blo od vessel morphogenesis	ISS	biological_process
GO:0001764	neuron migration	ISS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	TAS	biological_process
GO:0002040	sprouting angiogenesis	ISS	biological_process
GO:0002042	cell migration involved i n sprouting angiogenesis	ISS	biological_process
GO:0002116	semaphorin receptor compl ex	NAS	cellular_component
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	ISS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	NAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005769	early endosome	ISS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007411	axon guidance	NAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0009887	animal organ morphogenesi s	TAS	biological_process
GO:0010595	positive regulation of en dothelial cell migration	TAS	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	TAS	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0017154	semaphorin receptor activ ity	NAS	molecular_function
GO:0019838	growth factor binding	TAS	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019955	cytokine binding	NAS	molecular_function
GO:0021675	nerve development	ISS	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0031290	retinal ganglion cell axo n guidance	ISS	biological_process
GO:0031410	cytoplasmic vesicle	TAS	cellular_component
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IMP	biological_process
GO:0035767	endothelial cell chemotax is	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	ISS	biological_process
GO:0038085	vascular endothelial grow th factor binding	IPI	molecular_function
GO:0038190	VEGF-activated neuropilin signaling pathway	ISS	biological_process
GO:0043235	receptor complex	TAS	cellular_component
GO:0048008	platelet-derived growth f actor receptor signaling pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	IMP	biological_process
GO:0048842	positive regulation of ax on extension involved in axon guidance	ISS	biological_process
GO:0048844	artery morphogenesis	ISS	biological_process
GO:0048844	artery morphogenesis	ISS	biological_process
GO:0048846	axon extension involved i n axon guidance	ISS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IMP	biological_process
GO:0050918	positive chemotaxis	ISS	biological_process
GO:0060301	positive regulation of cy tokine activity	TAS	biological_process
GO:0060385	axonogenesis involved in innervation	ISS	biological_process
GO:0060627	regulation of vesicle-med iated transport	TAS	biological_process
GO:0060978	angiogenesis involved in coronary vascular morphog enesis	ISS	biological_process
GO:0061299	retina vasculature morpho genesis in camera-type ey e	ISS	biological_process
GO:0061549	sympathetic ganglion deve lopment	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0071526	semaphorin-plexin signali ng pathway	NAS	biological_process
GO:0071679	commissural neuron axon g uidance	ISS	biological_process
GO:0090259	regulation of retinal gan glion cell axon guidance	ISS	biological_process
GO:0097102	endothelial tip cell fate specification	ISS	biological_process
GO:0097443	sorting endosome	ISS	cellular_component
GO:0097490	sympathetic neuron projec tion extension	ISS	biological_process
GO:0097491	sympathetic neuron projec tion guidance	ISS	biological_process
GO:1901166	neural crest cell migrati on involved in autonomic nervous system developmen t	ISS	biological_process
GO:1902285	semaphorin-plexin signali ng pathway involved in ne uron projection guidance	ISS	biological_process
GO:1902336	positive regulation of re tinal ganglion cell axon guidance	ISS	biological_process
GO:1902946	protein localization to e arly endosome	ISS	biological_process

KEGG pathways

hsa05166 HTLV-I infection
hsa04360 Axon guidance

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 16385451
Cardiac stroke	PMID: 18984674
Diabetes	PMID: 20053475
Endometriosis	PMID: 23585340
Endometriosis	INFBASE23585340
Schizophrenia	PMID: 19054571
Several psychiatric disorders	PMID: 19086053

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23585340	Endometrio sis			79 (37 control, 42 endometrios is)		NRP-1 NRP-2 VEGF-D VEGF-C	Show abstract