Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 891
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary
Gene Symbol CCNB1   Gene   UCSC   Ensembl
Aliases CCNB
Gene name cyclin B1
Alternate names G2/mitotic-specific cyclin-B1,
Gene location 5q13.2 (69167009: 69178244)     Exons: 9     NC_000005.10
Gene summary(Entrez) The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites. [provided by RefSeq, Jul 2008]
OMIM 123836

SNPs

 rs10757269

Strand:    Allele origin:   Allele change: A/C/G   Mutation type: snp

CM000671.2   g.22072265A>C
CM000671.2   g.22072265A>G
NC_000009.11   g.22072264A>G
NC_000009.12   g.22072265A>C
NC_000009.12   g.22072265A>G
NR_003529.3   n.2448+5912A>C
NR_003529.3   n.2448+5912A>G
NR_047532.1   n.1075+15878A>C
NR_047532.1   n.1075+15878A>G
NR_047533.1   n.645-5414A>C
NR_047533.1   n.645-5414A>G
NR_047534.1   n.644+23037A>C
NR_047534.1   n.644+23037A>G
NR_047535.1   n.780+15878A>C
NR_047535.1   n.780+15878A>G
NR_047536.1   n.644+23037A>C
NR_047536.1   n.644+23037A>G
NR_047537.1   n.780+15878A>C
NR_047537.1   n.780+15878A>G
NR_047538.1   n.644+23037A>C
NR_047538.1   n.644+23037A>G
NR_047539.1   n.2449-5414A>C
NR_047539.1   n.2449-5414A>G
NR_047540.1   n.1049-5414A>C
NR_047540.1   n.1049-5414A>G
NR_047541.1   n.856-5414A>C
NR_047541.1   n.856-5414A>G
NR_047542.1   n.781-5414A>C
NR_047542.1   n.781-5414A>G
NR_047543.1   n.780+15878A>C
NR_047543.1   n.780+15878A>G
NR_120536.1   n.644+23037A>C
NR_120536.1   n.644+23037A>G
rs10757272

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000671.2   g.22088261C>T
NC_000009.11   g.22088260C>T
NC_000009.12   g.22088261C>T
NR_003529.3   n.2449-8111C>T
NR_047532.1   n.1076-4047C>T
NR_047534.1   n.645-8997C>T
NR_047535.1   n.781-24059C>T
NR_047536.1   n.645-24059C>T
NR_047537.1   n.780+31874C>T
NR_047538.1   n.645-31939C>T
NR_047543.1   n.781-24059C>T
NR_120536.1   n.645-32243C>T
rs10965215

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000671.2   g.22029446G>A
NC_000009.11   g.22029445G>A
NC_000009.12   g.22029446G>A
NR_003529.3   n.385G>A
NR_047532.1   n.385G>A
NR_047533.1   n.372-17305G>A
NR_047534.1   n.372-17305G>A
NR_047535.1   n.372-17305G>A
NR_047536.1   n.372-17305G>A
NR_047537.1   n.372-17305G>A
NR_047538.1   n.372-17305G>A
NR_047539.1   n.385G>A
NR_047540.1   n.372-17305G>A
NR_047541.1   n.372-17305G>A
NR_047542.1   n.372-17305G>A
NR_047543.1   n.372-17305G>A
NR_120536.1   n.372-17305G>A
rs10965235

Strand:    Allele origin:   Allele change: A/C   Mutation type: snp

CM000671.2   g.22115106C>A
NC_000009.11   g.22115105C>A
NC_000009.12   g.22115106C>A
NR_003529.3   n.2908+1307C>A
NR_047532.1   n.1697+1307C>A
NR_047534.1   n.961+1307C>A
NR_047535.1   n.856+2711C>A
NR_047536.1   n.720+2711C>A
NR_047537.1   n.781-5094C>A
NR_047538.1   n.645-5094C>A
NR_047543.1   n.990+1307C>A
NR_120536.1   n.645-5398C>A
rs1333042

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000671.2   g.22103814A>G
NC_000009.11   g.22103813A>G
NC_000009.12   g.22103814A>G
NR_003529.3   n.2698+6450A>G
NR_047532.1   n.1487+6450A>G
NR_047534.1   n.751+6450A>G
NR_047535.1   n.781-8506A>G
NR_047536.1   n.645-8506A>G
NR_047537.1   n.781-16386A>G
NR_047538.1   n.645-16386A>G
NR_047543.1   n.781-8506A>G
NR_120536.1   n.645-16690A>G
rs1537370

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000671.2   g.22084311C>T
NC_000009.11   g.22084310C>T
NC_000009.12   g.22084311C>T
NR_003529.3   n.2449-12061C>T
NR_047532.1   n.1076-7997C>T
NR_047534.1   n.645-12947C>T
NR_047535.1   n.780+27924C>T
NR_047536.1   n.645-28009C>T
NR_047537.1   n.780+27924C>T
NR_047538.1   n.644+35083C>T
NR_047543.1   n.780+27924C>T
NR_120536.1   n.644+35083C>T
rs17761446

Strand:    Allele origin:   Allele change: G/T   Mutation type: snp

CM000671.2   g.22118103T>G
NC_000009.11   g.22118102T>G
NC_000009.12   g.22118103T>G
NR_003529.3   n.2909-541T>G
NR_047532.1   n.1698-541T>G
NR_047534.1   n.962-541T>G
NR_047535.1   n.857-541T>G
NR_047536.1   n.721-541T>G
NR_047537.1   n.781-2097T>G
NR_047538.1   n.645-2097T>G
NR_047543.1   n.991-541T>G
NR_120536.1   n.645-2401T>G
rs17834457

Strand:    Allele origin:   Allele change: C/G/T   Mutation type: snp

CM000671.2   g.22118027C>G
CM000671.2   g.22118027C>T
NC_000009.11   g.22118026C>T
NC_000009.12   g.22118027C>G
NC_000009.12   g.22118027C>T
NR_003529.3   n.2909-617C>G
NR_003529.3   n.2909-617C>T
NR_047532.1   n.1698-617C>G
NR_047532.1   n.1698-617C>T
NR_047534.1   n.962-617C>G
NR_047534.1   n.962-617C>T
NR_047535.1   n.857-617C>G
NR_047535.1   n.857-617C>T
NR_047536.1   n.721-617C>G
NR_047536.1   n.721-617C>T
NR_047537.1   n.781-2173C>G
NR_047537.1   n.781-2173C>T
NR_047538.1   n.645-2173C>G
NR_047538.1   n.645-2173C>T
NR_047543.1   n.991-617C>G
NR_047543.1   n.991-617C>T
NR_120536.1   n.645-2477C>G
NR_120536.1   n.645-2477C>T
rs2157719

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000671.2   g.22033367C>T
NC_000009.11   g.22033366C>T
NC_000009.12   g.22033367C>T
NR_003529.3   n.846+381C>T
NR_047532.1   n.533+3773C>T
NR_047533.1   n.372-13384C>T
NR_047534.1   n.372-13384C>T
NR_047535.1   n.372-13384C>T
NR_047536.1   n.372-13384C>T
NR_047537.1   n.372-13384C>T
NR_047538.1   n.372-13384C>T
NR_047539.1   n.846+381C>T
NR_047540.1   n.372-13384C>T
NR_047541.1   n.372-13384C>T
NR_047542.1   n.372-13384C>T
NR_047543.1   n.372-13384C>T
NR_120536.1   n.372-13384C>T
rs2383206

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000671.2   g.22115027A>G
NC_000009.11   g.22115026A>G
NC_000009.12   g.22115027A>G
NR_003529.3   n.2908+1228A>G
NR_047532.1   n.1697+1228A>G
NR_047534.1   n.961+1228A>G
NR_047535.1   n.856+2632A>G
NR_047536.1   n.720+2632A>G
NR_047537.1   n.781-5173A>G
NR_047538.1   n.645-5173A>G
NR_047543.1   n.990+1228A>G
NR_120536.1   n.645-5477A>G
rs4977756

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000671.2   g.22068653G>A
NC_000009.11   g.22068652G>A
NC_000009.12   g.22068653G>A
NR_003529.3   n.2448+2300G>A
NR_047532.1   n.1075+12266G>A
NR_047533.1   n.645-9026G>A
NR_047534.1   n.644+19425G>A
NR_047535.1   n.780+12266G>A
NR_047536.1   n.644+19425G>A
NR_047537.1   n.780+12266G>A
NR_047538.1   n.644+19425G>A
NR_047539.1   n.2448+2300G>A
NR_047540.1   n.1048+2300G>A
NR_047541.1   n.855+4635G>A
NR_047542.1   n.781-9026G>A
NR_047543.1   n.780+12266G>A
NR_120536.1   n.644+19425G>A
rs6475606

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000671.2   g.22081851C>T
NC_000009.11   g.22081850C>T
NC_000009.12   g.22081851C>T
NR_003529.3   n.2449-14521C>T
NR_047532.1   n.1076-10457C>T
NR_047534.1   n.645-15407C>T
NR_047535.1   n.780+25464C>T
NR_047536.1   n.645-30469C>T
NR_047537.1   n.780+25464C>T
NR_047538.1   n.644+32623C>T
NR_047543.1   n.780+25464C>T
NR_120536.1   n.644+32623C>T
rs7865618

Strand:    Allele origin:   Allele change: A/G/T   Mutation type: snp

CM000671.2   g.22031006G>A
CM000671.2   g.22031006G>T
NC_000009.11   g.22031005G>A
NC_000009.12   g.22031006G>A
NC_000009.12   g.22031006G>T
NR_003529.3   n.533+1412G>A
NR_003529.3   n.533+1412G>T
NR_047532.1   n.533+1412G>A
NR_047532.1   n.533+1412G>T
NR_047533.1   n.372-15745G>A
NR_047533.1   n.372-15745G>T
NR_047534.1   n.372-15745G>A
NR_047534.1   n.372-15745G>T
NR_047535.1   n.372-15745G>A
NR_047535.1   n.372-15745G>T
NR_047536.1   n.372-15745G>A
NR_047536.1   n.372-15745G>T
NR_047537.1   n.372-15745G>A
NR_047537.1   n.372-15745G>T
NR_047538.1   n.372-15745G>A
NR_047538.1   n.372-15745G>T
NR_047539.1   n.533+1412G>A
NR_047539.1   n.533+1412G>T
NR_047540.1   n.372-15745G>A
NR_047540.1   n.372-15745G>T
NR_047541.1   n.372-15745G>A
NR_047541.1   n.372-15745G>T
NR_047542.1   n.372-15745G>A
NR_047542.1   n.372-15745G>T
NR_047543.1   n.372-15745G>A
NR_047543.1   n.372-15745G>T
NR_120536.1   n.372-15745G>A
NR_120536.1   n.372-15745G>T
rs944797

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000671.2   g.22115287T>C
NC_000009.11   g.22115286T>C
NC_000009.11   g.22115286T>G
NC_000009.12   g.22115287T>C
NR_003529.3   n.2908+1488T>C
NR_003529.3   n.2908+1488T>G
NR_047532.1   n.1697+1488T>C
NR_047532.1   n.1697+1488T>G
NR_047534.1   n.961+1488T>C
NR_047534.1   n.961+1488T>G
NR_047535.1   n.856+2892T>C
NR_047535.1   n.856+2892T>G
NR_047536.1   n.720+2892T>C
NR_047536.1   n.720+2892T>G
NR_047537.1   n.781-4913T>C
NR_047537.1   n.781-4913T>G
NR_047538.1   n.645-4913T>C
NR_047538.1   n.645-4913T>G
NR_047543.1   n.990+1488T>C
NR_047543.1   n.990+1488T>G
NR_120536.1   n.645-5217T>C
NR_120536.1   n.645-5217T>G

Protein Summary
Protein general information P14635  

Name: G2/mitotic specific cyclin B1

Length: 433  Mass: 48,337

Sequence MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVI
DKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVI
LAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYM
TVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEES
LLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Structural information
Interpro:  IPR013763 IPR004367 IPR006671
Prosite:   PS00292

Pfam:  		 PF02984 PF00134

PDB:  		 2B9R 2JGZ 4Y72 4YC3 5HQ0 5LQF
PDBsum:   2B9R 2JGZ 4Y72 4YC3 5HQ0 5LQF

DIP:  		 59
MINT:   1202632
STRING:   ENSP00000256442;
Other Databases GeneCards:  CCNB1;  Malacards:  CCNB1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000086 G2/M transition of mitoti
c cell cycle
 TAS biological_process
GO:0000922 spindle pole
 IDA cellular_component
GO:0000942 condensed nuclear chromos
ome outer kinetochore
 IDA cellular_component
GO:0001556 oocyte maturation
 IEA biological_process
GO:0001701 in utero embryonic develo
pment
 IEA biological_process
GO:0001933 negative regulation of pr
otein phosphorylation
 IEA biological_process
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0005113 patched binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005813 centrosome
 IDA cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0006461 protein complex assembly
 IEA biological_process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological_process
GO:0007052 mitotic spindle organizat
ion
 IMP biological_process
GO:0007077 mitotic nuclear envelope
disassembly
 TAS biological_process
GO:0007080 mitotic metaphase plate c
ongression
 IMP biological_process
GO:0007283 spermatogenesis
 IEA biological_process
GO:0009612 response to mechanical st
imulus
 IEA biological_process
GO:0010629 negative regulation of ge
ne expression
 IEA biological_process
GO:0016020 membrane
 IEA cellular_component
GO:0019901 protein kinase binding
 IPI molecular_function
GO:0031145 anaphase-promoting comple
x-dependent catabolic pro
cess
 TAS biological_process
GO:0031442 positive regulation of mR
NA 3'-end processing
 IEA biological_process
GO:0033129 positive regulation of hi
stone phosphorylation
 IEA biological_process
GO:0035173 histone kinase activity
 IEA molecular_function
GO:0042246 tissue regeneration
 IEA biological_process
GO:0042493 response to drug
 IEA biological_process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 TAS biological_process
GO:0045931 positive regulation of mi
totic cell cycle
 IMP biological_process
GO:0046680 response to DDT
 IEA biological_process
GO:0048146 positive regulation of fi
broblast proliferation
 IEA biological_process
GO:0048565 digestive tract developme
nt
 IEA biological_process
GO:0051301 cell division
 IEA biological_process
GO:0051436 negative regulation of ub
iquitin-protein ligase ac
tivity involved in mitoti
c cell cycle
 TAS biological_process
GO:0051437 positive regulation of ub
iquitin-protein ligase ac
tivity involved in regula
tion of mitotic cell cycl
e transition
 TAS biological_process
GO:0051439 regulation of ubiquitin-p
rotein ligase activity in
volved in mitotic cell cy
cle
 TAS biological_process
GO:0051726 regulation of cell cycle
 TAS biological_process
GO:0051987 positive regulation of at
tachment of spindle micro
tubules to kinetochore
 IMP biological_process
GO:0055015 ventricular cardiac muscl
e cell development
 IEA biological_process
GO:0060045 positive regulation of ca
rdiac muscle cell prolife
ration
 IEA biological_process
GO:0060623 regulation of chromosome
condensation
 IEA biological_process
GO:0071283 cellular response to iron
(III) ion
 IEA biological_process
GO:0071398 cellular response to fatt
y acid
 IEA biological_process
GO:0071407 cellular response to orga
nic cyclic compound
 IEA biological_process
GO:0071456 cellular response to hypo
xia
 IEA biological_process
GO:0090266 regulation of mitotic cel
l cycle spindle assembly
checkpoint
 IMP biological_process
GO:2000775 histone H3-S10 phosphoryl
ation involved in chromos
ome condensation
 IEA biological_process
GO:0000086 G2/M transition of mitoti
c cell cycle
 TAS biological_process
GO:0000278 mitotic cell cycle
 IEA biological_process
GO:0000922 spindle pole
 IDA cellular_component
GO:0000942 condensed nuclear chromos
ome outer kinetochore
 IDA cellular_component
GO:0001556 oocyte maturation
 IEA biological_process
GO:0001701 in utero embryonic develo
pment
 IEA biological_process
GO:0001933 negative regulation of pr
otein phosphorylation
 IEA biological_process
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0005113 patched binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IEA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IEA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005813 centrosome
 IDA cellular_component
GO:0005815 microtubule organizing ce
nter
 IEA cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005856 cytoskeleton
 IEA cellular_component
GO:0006461 protein complex assembly
 IEA biological_process
GO:0006468 protein phosphorylation
 IEA biological_process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological_process
GO:0007049 cell cycle
 IEA biological_process
GO:0007052 mitotic spindle organizat
ion
 IMP biological_process
GO:0007067 mitotic nuclear division
 IEA biological_process
GO:0007077 mitotic nuclear envelope
disassembly
 TAS biological_process
GO:0007080 mitotic metaphase plate c
ongression
 IMP biological_process
GO:0007283 spermatogenesis
 IEA biological_process
GO:0009612 response to mechanical st
imulus
 IEA biological_process
GO:0009636 response to toxic substan
ce
 IEA biological_process
GO:0010629 negative regulation of ge
ne expression
 IEA biological_process
GO:0016020 membrane
 IEA cellular_component
GO:0016301 kinase activity
 IEA molecular_function
GO:0019901 protein kinase binding
 IEA molecular_function
GO:0019901 protein kinase binding
 IPI molecular_function
GO:0031145 anaphase-promoting comple
x-dependent catabolic pro
cess
 TAS biological_process
GO:0031442 positive regulation of mR
NA 3'-end processing
 IEA biological_process
GO:0033129 positive regulation of hi
stone phosphorylation
 IEA biological_process
GO:0035173 histone kinase activity
 IEA molecular_function
GO:0042246 tissue regeneration
 IEA biological_process
GO:0042493 response to drug
 IEA biological_process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 TAS biological_process
GO:0045787 positive regulation of ce
ll cycle
 IEA biological_process
GO:0045931 positive regulation of mi
totic cell cycle
 IMP biological_process
GO:0046680 response to DDT
 IEA biological_process
GO:0048146 positive regulation of fi
broblast proliferation
 IEA biological_process
GO:0048565 digestive tract developme
nt
 IEA biological_process
GO:0051301 cell division
 IEA biological_process
GO:0051436 negative regulation of ub
iquitin-protein ligase ac
tivity involved in mitoti
c cell cycle
 TAS biological_process
GO:0051437 positive regulation of ub
iquitin-protein ligase ac
tivity involved in regula
tion of mitotic cell cycl
e transition
 TAS biological_process
GO:0051439 regulation of ubiquitin-p
rotein ligase activity in
volved in mitotic cell cy
cle
 TAS biological_process
GO:0051726 regulation of cell cycle
 IEA biological_process
GO:0051726 regulation of cell cycle
 TAS biological_process
GO:0051987 positive regulation of at
tachment of spindle micro
tubules to kinetochore
 IMP biological_process
GO:0055015 ventricular cardiac muscl
e cell development
 IEA biological_process
GO:0060045 positive regulation of ca
rdiac muscle cell prolife
ration
 IEA biological_process
GO:0060623 regulation of chromosome
condensation
 IEA biological_process
GO:0071283 cellular response to iron
(III) ion
 IEA biological_process
GO:0071398 cellular response to fatt
y acid
 IEA biological_process
GO:0071407 cellular response to orga
nic cyclic compound
 IEA biological_process
GO:0071456 cellular response to hypo
xia
 IEA biological_process
GO:0090266 regulation of mitotic cel
l cycle spindle assembly
checkpoint
 IMP biological_process
GO:2000775 histone H3-S10 phosphoryl
ation involved in chromos
ome condensation
 IEA biological_process
GO:0000086 G2/M transition of mitoti
c cell cycle
 TAS biological_process
GO:0000922 spindle pole
 IDA cellular_component
GO:0000942 condensed nuclear chromos
ome outer kinetochore
 IDA cellular_component
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0004693 cyclin-dependent protein
serine/threonine kinase a
ctivity
 TAS molecular_function
GO:0005113 patched binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005634 nucleus
 IDA cellular_component
GO:0005634 nucleus
 IDA cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005654 nucleoplasm
 TAS cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005737 cytoplasm
 IDA cellular_component
GO:0005813 centrosome
 IDA cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0005829 cytosol
 TAS cellular_component
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
 TAS biological_process
GO:0007052 mitotic spindle organizat
ion
 IMP biological_process
GO:0007077 mitotic nuclear envelope
disassembly
 TAS biological_process
GO:0007080 mitotic metaphase plate c
ongression
 IMP biological_process
GO:0019901 protein kinase binding
 IPI molecular_function
GO:0031145 anaphase-promoting comple
x-dependent catabolic pro
cess
 TAS biological_process
GO:0042787 protein ubiquitination in
volved in ubiquitin-depen
dent protein catabolic pr
ocess
 TAS biological_process
GO:0045931 positive regulation of mi
totic cell cycle
 IMP biological_process
GO:0051436 negative regulation of ub
iquitin-protein ligase ac
tivity involved in mitoti
c cell cycle
 TAS biological_process
GO:0051437 positive regulation of ub
iquitin-protein ligase ac
tivity involved in regula
tion of mitotic cell cycl
e transition
 TAS biological_process
GO:0051439 regulation of ubiquitin-p
rotein ligase activity in
volved in mitotic cell cy
cle
 TAS biological_process
GO:0051726 regulation of cell cycle
 TAS biological_process
GO:0051987 positive regulation of at
tachment of spindle micro
tubules to kinetochore
 IMP biological_process
GO:0090266 regulation of mitotic cel
l cycle spindle assembly
checkpoint
 IMP biological_process

KEGG pathways

hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04914  Progesterone-mediated oocyte maturation
hsa04115  p53 signaling pathway
hsa04114  Oocyte meiosis

Diseases

Associated diseases References
Endometriosis PMID: 18353325
Male infertility PMID: 16155078
Endometriosis INFBASE18353325

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
18353325 Endometrio
sis

Female infertility cyclin B1
cdc2
and Plk1
 Show abstract
17425849 Endometrio
sis
65 (29 patients
with endometri
osis, 30 women
without endomet
riosis)
Show abstract