Endometriosis Knowledgebase

Search Result

Gene id

9021

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SOCS3 Gene UCSC Ensembl

Aliases

ATOD4, CIS3, Cish3, SOCS-3, SSI-3, SSI3

Gene name

suppressor of cytokine signaling 3

Alternate names

suppressor of cytokine signaling 3, STAT-induced STAT inhibitor 3, cytokine-inducible SH2 protein 3,

Gene location

17q25.3 (78360078: 78356776) Exons: 2 NC_000017.11

Gene summary(Entrez)

This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development. [provided by RefSeq, Jul 2008]

OMIM

604176

Protein Summary

Protein general information

O14543

Name: Suppressor of cytokine signaling 3 (SOCS 3) (Cytokine inducible SH2 protein 3) (CIS 3) (STAT induced STAT inhibitor 3) (SSI 3)

Length: 225 Mass: 24,770

Tissue specificity: Widely expressed with high expression in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney. Lower levels in thymus.

Sequence

MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSD
QRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQ
PSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Structural information

Protein Domains	SH2. (46-142) SOCS (177-224)
Interpro:	IPR000980 IPR028414 IPR001496
Prosite:	PS50001 PS50225
Pfam:	PF00017 PF07525
MINT:	149732
STRING:	ENSP00000330341;

Other Databases

GeneCards: SOCS3; Malacards: SOCS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological_process
GO:0004860	protein kinase inhibitor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IEA	biological_process
GO:0007259	JAK-STAT cascade	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0010332	response to gamma radiati on	IEA	biological_process
GO:0016567	protein ubiquitination	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0032094	response to food	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0040008	regulation of growth	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0045597	positive regulation of ce ll differentiation	IEA	biological_process
GO:0046426	negative regulation of JA K-STAT cascade	IBA	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	IBA	biological_process
GO:0050728	negative regulation of in flammatory response	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological_process
GO:0060670	branching involved in lab yrinthine layer morphogen esis	IEA	biological_process
GO:0060674	placenta blood vessel dev elopment	IEA	biological_process
GO:0060707	trophoblast giant cell di fferentiation	IEA	biological_process
GO:0060708	spongiotrophoblast differ entiation	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001932	regulation of protein pho sphorylation	IEA	biological_process
GO:0004860	protein kinase inhibitor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007259	JAK-STAT cascade	IEA	biological_process
GO:0007259	JAK-STAT cascade	IEA	biological_process
GO:0007259	JAK-STAT cascade	TAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0009617	response to bacterium	IEA	biological_process
GO:0009725	response to hormone	IEA	biological_process
GO:0009968	negative regulation of si gnal transduction	IEA	biological_process
GO:0009968	negative regulation of si gnal transduction	IEA	biological_process
GO:0010332	response to gamma radiati on	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016567	protein ubiquitination	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0032094	response to food	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0034097	response to cytokine	IEA	biological_process
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0040008	regulation of growth	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0045595	regulation of cell differ entiation	IEA	biological_process
GO:0045597	positive regulation of ce ll differentiation	IEA	biological_process
GO:0046426	negative regulation of JA K-STAT cascade	IBA	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	IEA	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	IBA	biological_process
GO:0050728	negative regulation of in flammatory response	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological_process
GO:0060670	branching involved in lab yrinthine layer morphogen esis	IEA	biological_process
GO:0060674	placenta blood vessel dev elopment	IEA	biological_process
GO:0060707	trophoblast giant cell di fferentiation	IEA	biological_process
GO:0060708	spongiotrophoblast differ entiation	IEA	biological_process
GO:0004860	protein kinase inhibitor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0007259	JAK-STAT cascade	TAS	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0046426	negative regulation of JA K-STAT cascade	IBA	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	IBA	biological_process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological_process

KEGG pathways

hsa05168  Herpes simplex infection
hsa05164  Influenza A
hsa04630  Jak-STAT signaling pathway
hsa04668  TNF signaling pathway
hsa04380  Osteoclast differentiation
hsa04932  Non-alcoholic fatty liver disease
hsa05160  Hepatitis C
hsa04917  Prolactin signaling pathway
hsa04910  Insulin signaling pathway
hsa04931  Insulin resistance
hsa04920  Adipocytokine signaling pathway
hsa04930  Type II diabetes mellitus
hsa04120  Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Cancer	PMID: 18636124
Diabetes	PMID: 15249995
Endometriosis	PMID: 24246915
Endometriosis	INFBASE24246915
Obesity	PMID: 17445271
Polycystic ovary syndrome (PCOS)	PMID: 23603633
Unexplained infertility	PMID: 24368037

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24246915	Endometrio sis			62 (32 patients with endometri osis, 30 women without endomet riosis)			Show abstract