Endometriosis Knowledgebase

Search Result

Gene id

90226

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

UCN2 Gene UCSC Ensembl

Aliases

SRP, UCN-II, UCNI, UR, URP

Gene name

urocortin 2

Alternate names

urocortin-2, prepro-urocortin 2, stresscopin-related peptide, ucn II, urocortin II, urocortin-related peptide,

Gene location

3p21.31 (48563767: 48561717) Exons: 2 NC_000003.12

Gene summary(Entrez)

This gene is a member of the sauvagine/corticotropin-releasing factor/urotensin I family. It is structurally related to the corticotropin-releasing factor (CRF) gene and the encoded product is an endogenous ligand for CRF type 2 receptors. In the brain it may be responsible for the effects of stress on appetite. In spite of the gene family name similarity, the product of this gene has no sequence similarity to urotensin II. [provided by RefSeq, Jul 2008]

OMIM

605902

Protein Summary

Protein general information

Q96RP3

Name: Urocortin-2 (Stresscopin-related peptide) (Urocortin II) (Ucn II) (Urocortin-related peptide)

Length: 112 Mass: 12,146

Sequence

MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLS
LDVPIGLLQILLEQARARAAREQATTNARILARVGHC

Structural information

Interpro:	IPR000187 IPR024273 IPR024270
Pfam:	PF00473
PDB:	2RMG 3N95
PDBsum:	2RMG 3N95
STRING:	ENSP00000273610;

Other Databases

GeneCards: UCN2; Malacards: UCN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001664	G-protein coupled recepto r binding	IBA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006171	cAMP biosynthetic process	IEP	biological_process
GO:0006950	response to stress	NAS	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IBA	biological_process
GO:0007586	digestion	NAS	biological_process
GO:0008283	cell proliferation	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0031669	cellular response to nutr ient levels	IBA	biological_process
GO:0033685	negative regulation of lu teinizing hormone secreti on	IEA	biological_process
GO:0035902	response to immobilizatio n stress	IEA	biological_process
GO:0042562	hormone binding	IPI	molecular_function
GO:0046882	negative regulation of fo llicle-stimulating hormon e secretion	IEA	biological_process
GO:0051431	corticotropin-releasing h ormone receptor 2 binding	IEA	molecular_function
GO:0071385	cellular response to gluc ocorticoid stimulus	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0001664	G-protein coupled recepto r binding	IEA	molecular_function
GO:0001664	G-protein coupled recepto r binding	IBA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006171	cAMP biosynthetic process	IEP	biological_process
GO:0006950	response to stress	IEA	biological_process
GO:0006950	response to stress	NAS	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IBA	biological_process
GO:0007586	digestion	IEA	biological_process
GO:0007586	digestion	NAS	biological_process
GO:0008283	cell proliferation	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0031669	cellular response to nutr ient levels	IBA	biological_process
GO:0033685	negative regulation of lu teinizing hormone secreti on	IEA	biological_process
GO:0035902	response to immobilizatio n stress	IEA	biological_process
GO:0042562	hormone binding	IPI	molecular_function
GO:0046882	negative regulation of fo llicle-stimulating hormon e secretion	IEA	biological_process
GO:0051431	corticotropin-releasing h ormone receptor 2 binding	IEA	molecular_function
GO:0051431	corticotropin-releasing h ormone receptor 2 binding	IEA	molecular_function
GO:0071385	cellular response to gluc ocorticoid stimulus	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0001664	G-protein coupled recepto r binding	IBA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006171	cAMP biosynthetic process	IEP	biological_process
GO:0006950	response to stress	NAS	biological_process
GO:0007189	adenylate cyclase-activat ing G-protein coupled rec eptor signaling pathway	IBA	biological_process
GO:0007586	digestion	NAS	biological_process
GO:0031669	cellular response to nutr ient levels	IBA	biological_process
GO:0042562	hormone binding	IPI	molecular_function

Diseases

Associated diseases	References
Endometriosis	PubMed27567427

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27567427	Endometrio sis					CRH Ucn �Ucn2 CRH-receptors (type-1 and type-2)	Show abstract