Endometriosis Knowledgebase

Search Result

Gene id

90993

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CREB3L1 Gene UCSC Ensembl

Aliases

OASIS

Gene name

cAMP responsive element binding protein 3 like 1

Alternate names

cyclic AMP-responsive element-binding protein 3-like protein 1, BBF-2 homolog, cAMP-responsive element-binding protein 3-like protein 1, old astrocyte specifically-induced substance,

Gene location

11p11.2 (: ) Exons:

Gene summary(Entrez)

The protein encoded by this gene is normally found in the membrane of the endoplasmic reticulum (ER). However, upon stress to the ER, the encoded protein is cleaved and the released cytoplasmic transcription factor domain translocates to the nucleus. There it activates the transcription of target genes by binding to box-B elements. [provided by RefSeq, Jun 2013]

Protein Summary

Protein general information

Q96BA8

Name: Cyclic AMP-responsive element-binding protein 3-like protein 1 (cAMP-responsive element-binding protein 3-like protein 1) (Old astrocyte specifically-induced substance) (OASIS) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like

Length: 519 Mass: 57,005

Tissue specificity: Expressed in several tissues, with highest levels in pancreas and prostate. Expressed at relatively lower levels in brain. {ECO

Sequence

MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMEL
DSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQEQSPELPVDPLAAPSAMAAA
AAMATTPLLGLSPLSRLPIPHQAPGEMTQLPVIKAEPLEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSL
PPSSPVRPMARSSTAISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNKISRPYKMAATQTGTC
LMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPLAADGVYTASQMPSRSLLFYDDGAGLWEDGRSTLLPMEPPDG
WEINPGGPAEQRPRDHLQHDHLDSTHETTKYLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS

Structural information

Protein Domains	bZIP. (290-353)
Motifs	S2P recognition.(392-395) S1P recognition.(423-426)
Interpro:	IPR004827 IPR001630 IPR029805
Prosite:	PS50217 PS00036
Pfam:	PF00170
MINT:
STRING:	ENSP00000434939;

Other Databases

GeneCards: CREB3L1; Malacards: CREB3L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	ISS	molecular_function
GO:0001649	osteoblast differentiatio n	ISS	biological_process
GO:0003682	chromatin binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030968	endoplasmic reticulum unf olded protein response	ISS	biological_process
GO:0035497	cAMP response element bin ding	ISS	molecular_function
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	ISS	molecular_function
GO:0070278	extracellular matrix cons tituent secretion	ISS	biological_process
GO:1902236	negative regulation of en doplasmic reticulum stres s-induced intrinsic apopt otic signaling pathway	ISS	biological_process
GO:1990440	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to endoplasmic reti culum stress	ISS	biological_process
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	ISS	molecular_function
GO:0001649	osteoblast differentiatio n	ISS	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003682	chromatin binding	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006986	response to unfolded prot ein	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030968	endoplasmic reticulum unf olded protein response	IEA	biological_process
GO:0030968	endoplasmic reticulum unf olded protein response	ISS	biological_process
GO:0035497	cAMP response element bin ding	IEA	molecular_function
GO:0035497	cAMP response element bin ding	ISS	molecular_function
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	ISS	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0070278	extracellular matrix cons tituent secretion	ISS	biological_process
GO:1902236	negative regulation of en doplasmic reticulum stres s-induced intrinsic apopt otic signaling pathway	IEA	biological_process
GO:1902236	negative regulation of en doplasmic reticulum stres s-induced intrinsic apopt otic signaling pathway	ISS	biological_process
GO:1990440	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to endoplasmic reti culum stress	IEA	biological_process
GO:1990440	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to endoplasmic reti culum stress	ISS	biological_process
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	ISS	molecular_function
GO:0001649	osteoblast differentiatio n	ISS	biological_process
GO:0003682	chromatin binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0030968	endoplasmic reticulum unf olded protein response	ISS	biological_process
GO:0035497	cAMP response element bin ding	ISS	molecular_function
GO:0044212	transcription regulatory region DNA binding	ISS	molecular_function
GO:0070278	extracellular matrix cons tituent secretion	ISS	biological_process
GO:1902236	negative regulation of en doplasmic reticulum stres s-induced intrinsic apopt otic signaling pathway	ISS	biological_process
GO:1990440	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to endoplasmic reti culum stress	ISS	biological_process

KEGG pathways

hsa05165  Human papillomavirus infection
hsa05161  Hepatitis B
hsa04934  Cushing's syndrome
hsa04931  Insulin resistance
hsa05034  Alcoholism
hsa05031  Amphetamine addiction
hsa05030  Cocaine addiction
hsa05016  Huntington's disease
hsa05215  Prostate cancer
hsa05203  Viral carcinogenesis
hsa04714  Thermogenesis
hsa04211  Longevity regulating pathway
hsa04728  Dopaminergic synapse
hsa04725  Cholinergic synapse
hsa04962  Vasopressin-regulated water reabsorption
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04927  Cortisol synthesis and secretion
hsa04925  Aldosterone synthesis and secretion
hsa04916  Melanogenesis
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04918  Thyroid hormone synthesis
hsa04926  Relaxin signaling pathway
hsa04915  Estrogen signaling pathway
hsa04922  Glucagon signaling pathway
hsa04911  Insulin secretion
hsa04152  AMPK signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04668  TNF signaling pathway

Diseases

Associated diseases	References
Endometriosis	PubMed26917262

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26917262	Endometrio sis						Show abstract