Endometriosis Knowledgebase

Search Result

Gene id

9113

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

LATS1 Gene UCSC Ensembl

Aliases

WARTS, wts

Gene name

large tumor suppressor kinase 1

Alternate names

serine/threonine-protein kinase LATS1, LATS (large tumor suppressor, Drosophila) homolog 1, LATS, large tumor suppressor, homolog 1, WARTS protein kinase, h-warts, large tumor suppressor homolog 1,

Gene location

6q25.1 (149718255: 149658152) Exons: 16 NC_000006.12

Gene summary(Entrez)

The protein encoded by this gene is a putative serine/threonine kinase that localizes to the mitotic apparatus and complexes with cell cycle controller CDC2 kinase in early mitosis. The protein is phosphorylated in a cell-cycle dependent manner, with late prophase phosphorylation remaining through metaphase. The N-terminal region of the protein binds CDC2 to form a complex showing reduced H1 histone kinase activity, indicating a role as a negative regulator of CDC2/cyclin A. In addition, the C-terminal kinase domain binds to its own N-terminal region, suggesting potential negative regulation through interference with complex formation via intramolecular binding. Biochemical and genetic data suggest a role as a tumor suppressor. This is supported by studies in knockout mice showing development of soft-tissue sarcomas, ovarian stromal cell tumors and a high sensitivity to carcinogenic treatments. [provided by RefSeq, Apr 2017]

OMIM

603473

Protein Summary

Protein general information

O95835

Name: Serine/threonine protein kinase LATS1 (EC 2.7.11.1) (Large tumor suppressor homolog 1) (WARTS protein kinase) (h warts)

Length: 1130 Mass: 126,870

Tissue specificity: Expressed in all adult tissues examined except for lung and kidney. {ECO

Sequence

MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHH
KALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVIQALQKTNNRSIEAAIEFISKMSYQDPRREQ
MAAAAARPINASMKPGNVQQSVNRKQSWKGSKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQ
AHPSNGQRVNPPPPPQVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGY
PPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNGTGQTDFMIHQNVVPAGTVNRQPPPP
YPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNMELYNISVPGLQTNWPQSSSAPAQSSPSSGHE
IPTWQPNIPVRSNSFNNPLGNRASHSANSQPSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQ
TVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENV
DSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQ
DAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHV
KAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFI
HRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAAR
QHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQA
KLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSD
DNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNR
DLVYV

Structural information

Protein Domains	UBA. (100-141) Protein (705-1010) AGC-kinase (1011-1090)
Motifs	PPxY motif(373-376) PPxY motif(556-559)
Interpro:	IPR000961 IPR011009 IPR028741 IPR000719 IPR008271 IPR015940 IPR009060
Prosite:	PS51285 PS50011 PS00108 PS50030
Pfam:	PF00069 PF00627
PDB:	4ZRK 5B5W 5BRK
PDBsum:	4ZRK 5B5W 5BRK
DIP:	31516
MINT:	2799169
STRING:	ENSP00000253339;

Other Databases

GeneCards: LATS1; Malacards: LATS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitoti c cell cycle	IBA	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IDA	biological_process
GO:0000287	magnesium ion binding	IDA	molecular_function
GO:0000819	sister chromatid segregat ion	IDA	biological_process
GO:0000922	spindle pole	IDA	cellular_component
GO:0001827	inner cell mass cell fate commitment	IEA	biological_process
GO:0001828	inner cell mass cellular morphogenesis	IEA	biological_process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IDA	molecular_function
GO:0005815	microtubule organizing ce nter	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0007067	mitotic nuclear division	IEA	biological_process
GO:0009755	hormone-mediated signalin g pathway	ISS	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030216	keratinocyte differentiat ion	IEA	biological_process
GO:0030833	regulation of actin filam ent polymerization	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0035329	hippo signaling	IDA	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IBA	biological_process
GO:0043254	regulation of protein com plex assembly	IMP	biological_process
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0046620	regulation of organ growt h	IBA	biological_process
GO:0051220	cytoplasmic sequestering of protein	IMP	biological_process
GO:0051301	cell division	IEA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IMP	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IBA	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IDA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000287	magnesium ion binding	IDA	molecular_function
GO:0000819	sister chromatid segregat ion	IDA	biological_process
GO:0000922	spindle pole	IDA	cellular_component
GO:0001827	inner cell mass cell fate commitment	IEA	biological_process
GO:0001828	inner cell mass cellular morphogenesis	IEA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IDA	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005815	microtubule organizing ce nter	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007067	mitotic nuclear division	IEA	biological_process
GO:0007067	mitotic nuclear division	IEA	biological_process
GO:0009755	hormone-mediated signalin g pathway	IEA	biological_process
GO:0009755	hormone-mediated signalin g pathway	ISS	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030216	keratinocyte differentiat ion	IEA	biological_process
GO:0030833	regulation of actin filam ent polymerization	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0034613	cellular protein localiza tion	IEA	biological_process
GO:0035329	hippo signaling	IEA	biological_process
GO:0035329	hippo signaling	IEA	biological_process
GO:0035329	hippo signaling	IDA	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IBA	biological_process
GO:0043254	regulation of protein com plex assembly	IMP	biological_process
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0046620	regulation of organ growt h	IBA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051220	cytoplasmic sequestering of protein	IMP	biological_process
GO:0051301	cell division	IEA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IMP	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IBA	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IDA	biological_process
GO:0000287	magnesium ion binding	IDA	molecular_function
GO:0000819	sister chromatid segregat ion	IDA	biological_process
GO:0000922	spindle pole	IDA	cellular_component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IDA	molecular_function
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0009755	hormone-mediated signalin g pathway	ISS	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030833	regulation of actin filam ent polymerization	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0035329	hippo signaling	IDA	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IBA	biological_process
GO:0043254	regulation of protein com plex assembly	IMP	biological_process
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0046620	regulation of organ growt h	IBA	biological_process
GO:0051220	cytoplasmic sequestering of protein	IMP	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IMP	biological_process

KEGG pathways

hsa04390 Hippo signaling pathway
hsa04392 Hippo signaling pathway -multiple species

Diseases

Associated diseases	References
Endometriosis	PMID: 28608501
Hyperandrogenism	PMID: 26427146
Polycystic ovary syndrome (PCOS)	PMID: 19542541
Endometriosis	INFBASE28608501

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28608501	Endometrio sis					YAP1	Show abstract