Endometriosis Knowledgebase

Search Result

Gene id

9173

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL1RL1 Gene UCSC Ensembl

Aliases

DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1

Gene name

interleukin 1 receptor like 1

Alternate names

interleukin-1 receptor-like 1, growth stimulation-expressed, homolog of mouse growth stimulation-expressed, interleukin 1 receptor-related protein,

Gene location

2q12.1 (102311501: 102352366) Exons: 13 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]

OMIM

601203

Protein Summary

Protein general information

Q01638

Name: Interleukin 1 receptor like 1 (Protein ST2)

Length: 556 Mass: 63,358

Tissue specificity: Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and t

Sequence

MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFL
PAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKN
CQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEV
EIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
YDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLLWRDIAKPYKTRNDGK
LYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTP
QITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNS
KFWKHVRYQMPVPSKIPRKASSLTPLAAQKQ

Structural information

Protein Domains	Ig-like (19-103) Ig-like (114-197) Ig-like (212-319) TIR. (375-538)
Interpro:	IPR007110 IPR013783 IPR013098 IPR003599 IPR003598 IPR015621 IPR004074 IPR000157
Prosite:	PS50835 PS50104
Pfam:	PF07679 PF01582
PDB:	4KC3
PDBsum:	4KC3
DIP:	37861
STRING:	ENSP00000233954;

Other Databases

GeneCards: IL1RL1; Malacards: IL1RL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002113	interleukin-33 binding	IEA	molecular_function
GO:0002114	interleukin-33 receptor a ctivity	IEA	molecular_function
GO:0002826	negative regulation of T- helper 1 type immune resp onse	IEA	biological_process
GO:0004896	cytokine receptor activit y	TAS	molecular_function
GO:0004908	interleukin-1 receptor ac tivity	IEA	molecular_function
GO:0005057	signal transducer activit y, downstream of receptor	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006955	immune response	NAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0032689	negative regulation of in terferon-gamma production	IEA	biological_process
GO:0032754	positive regulation of in terleukin-5 production	IEA	biological_process
GO:0038172	interleukin-33-mediated s ignaling pathway	IEA	biological_process
GO:0043032	positive regulation of ma crophage activation	IEA	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IEA	biological_process
GO:0090197	positive regulation of ch emokine secretion	IEA	biological_process
GO:1901653	cellular response to pept ide	IEA	biological_process
GO:0002113	interleukin-33 binding	IEA	molecular_function
GO:0002114	interleukin-33 receptor a ctivity	IEA	molecular_function
GO:0002826	negative regulation of T- helper 1 type immune resp onse	IEA	biological_process
GO:0004896	cytokine receptor activit y	TAS	molecular_function
GO:0004908	interleukin-1 receptor ac tivity	IEA	molecular_function
GO:0005057	signal transducer activit y, downstream of receptor	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006955	immune response	NAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0032689	negative regulation of in terferon-gamma production	IEA	biological_process
GO:0032754	positive regulation of in terleukin-5 production	IEA	biological_process
GO:0038172	interleukin-33-mediated s ignaling pathway	IEA	biological_process
GO:0043032	positive regulation of ma crophage activation	IEA	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IEA	biological_process
GO:0090197	positive regulation of ch emokine secretion	IEA	biological_process
GO:1901653	cellular response to pept ide	IEA	biological_process
GO:0004896	cytokine receptor activit y	TAS	molecular_function
GO:0005057	signal transducer activit y, downstream of receptor	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006955	immune response	NAS	biological_process
GO:0007165	signal transduction	TAS	biological_process

Diseases

Associated diseases	References
Asthma	PMID: 18774397
Cancer	PMID: 19074885
Endometriosis	PMID: 25069762
Endometriosis	INFBASE25069762
Nasal polyposis	PMID: 19860791
Rheumatoid arthritis	PMID: 19898481
Rhinitis	PMID: 19671251

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25069762	Endometrio sis			23 (15 women af fected by endom etriosis, 8 con trols)		Gal-3 ST2	Show abstract
25977120	Endometrio sis		Tunisia n	50 (30 women wi th laparoscopic and histopatho logical confirm ed endometriosi s, 20 control w omen without pe lvic pathology)		ST2 IL-33	Show abstract