Endometriosis Knowledgebase

Search Result

Gene id

9308

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CD83 Gene UCSC Ensembl

Aliases

BL11, HB15

Gene name

CD83 molecule

Alternate names

CD83 antigen, B-cell activation protein, CD83 antigen (activated B lymphocytes, immunoglobulin superfamily), cell surface protein HB15, cell-surface glycoprotein, hCD83,

Gene location

6p23 (49689522: 49683946) Exons: 18 NC_000003.12

Gene summary(Entrez)

The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

OMIM

604534

Protein Summary

Protein general information

Q01151

Name: CD83 antigen (hCD83) (B-cell activation protein) (Cell surface protein HB15) (CD antigen CD83)

Length: 205 Mass: 23,042

Tissue specificity: Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.

Sequence

MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQ
KGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLA
LVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV

Structural information

Protein Domains	Ig-like (20-114)
Interpro:	IPR007110 IPR036179 IPR013783 IPR003599 IPR013106
Prosite:	PS50835
Pfam:	PF07686
PDB:	5MIX 5MJ0 5MJ1 5MJ2
PDBsum:	5MIX 5MJ0 5MJ1 5MJ2
STRING:	ENSP00000368450;

Other Databases

GeneCards: CD83; Malacards: CD83

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001817	regulation of cytokine pr oduction	IBA	biological_process
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006952	defense response	TAS	biological_process
GO:0006959	humoral immune response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0032713	negative regulation of in terleukin-4 production	IEA	biological_process
GO:0032733	positive regulation of in terleukin-10 production	IEA	biological_process
GO:0032743	positive regulation of in terleukin-2 production	IEA	biological_process
GO:0043372	positive regulation of CD 4-positive, alpha-beta T cell differentiation	IEA	biological_process
GO:0001817	regulation of cytokine pr oduction	IBA	biological_process
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006952	defense response	TAS	biological_process
GO:0006959	humoral immune response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0032713	negative regulation of in terleukin-4 production	IEA	biological_process
GO:0032733	positive regulation of in terleukin-10 production	IEA	biological_process
GO:0032743	positive regulation of in terleukin-2 production	IEA	biological_process
GO:0043372	positive regulation of CD 4-positive, alpha-beta T cell differentiation	IEA	biological_process
GO:0001817	regulation of cytokine pr oduction	IBA	biological_process
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006952	defense response	TAS	biological_process
GO:0006959	humoral immune response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process

Diseases

Associated diseases	References
Adenocarcinoma	GAD18056445
Multiple Sclerosis	GAD19010793
Cervical cancer	GAD19446866
Endometriosis	PubMed19321495

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19321495	Endometrio sis			61(33 women wit h endometriosis , 28 without en dometriosis )		CD1a	Show abstract