Endometriosis Knowledgebase

Search Result

Gene id

93185

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IGSF8 Gene UCSC Ensembl

Aliases

CD316, CD81P3, EWI-2, EWI2, KCT-4, LIR-D1, PGRL

Gene name

immunoglobulin superfamily member 8

Alternate names

immunoglobulin superfamily member 8, CD81 partner 3, glu-Trp-Ile EWI motif-containing protein 2, keratinocytes-associated transmembrane protein 4, prostaglandin regulatory-like protein,

Gene location

1q23.2 (177265130: 177230302) Exons: 6 NC_000002.12

Gene summary(Entrez)

This gene encodes a member the EWI subfamily of the immunoglobulin protein superfamily. Members of this family contain a single transmembrane domain, an EWI (Glu-Trp-Ile)-motif and a variable number of immunoglobulin domains. This protein interacts with the tetraspanins CD81 and CD9 and may regulate their role in certain cellular functions including cell migration and viral infection. The encoded protein may also function as a tumor suppressor by inhibiting the proliferation of certain cancers. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2011]

OMIM

606644

Protein Summary

Protein general information

Q969P0

Name: Immunoglobulin superfamily member 8 (IgSF8) (CD81 partner 3) (Glu-Trp-Ile EWI motif-containing protein 2) (EWI-2) (Keratinocytes-associated transmembrane protein 4) (KCT-4) (LIR-D1) (Prostaglandin regulatory-like protein) (PGRL) (CD antigen CD316)

Length: 613 Mass: 65,034

Tissue specificity: Expressed in brain, kidney, testis, liver and placenta with moderate expression in all other tissues. Detected on a majority of B-cells, T-cells, and natural killer cells but not on monocytes, polynuclear cells and platelets. {ECO

Sequence

MGALRPTLLPPSLPLLLLLMLGMGCWAREVLVPEGPLYRVAGTAVSISCNVTGYEGPAQQNFEWFLYRPEAPDTA
LGIVSTKDTQFSYAVFKSRVVAGEVQVQRLQGDAVVLKIARLQAQDAGIYECHTPSTDTRYLGSYSGKVELRVLP
DVLQVSAAPPGPRGRQAPTSPPRMTVHEGQELALGCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEVVGIRSD
LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQT
LSSQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAAYSVGWEMAPAGAPGPGRLVAQLDTEGVGSLGPGYE
GRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGG
TVYRGETASLLCNISVRGGPPGLRLAASWWVERPEDGELSSVPAQLVGGVGQDGVAELGVRPGGGPVSVELVGPR
SHRLRLHSLGPEDEGVYHCAPSAWVQHADYSWYQAGSARSGPVTVYPYMHALDTLFVPLLVGTGVALVTGATVLG
TITCCFMKRLRKR

Structural information

Protein Domains	Ig-like (28-149) Ig-like (162-286) Ig-like (303-424) Ig-like (431-560)
Motifs	EWI motif.(274-276)
Interpro:	IPR007110 IPR036179 IPR013783 IPR003599 IPR013106
Prosite:	PS50835
Pfam:	PF07686
MINT:
STRING:	ENSP00000316664;

Other Databases

GeneCards: IGSF8; Malacards: IGSF8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006928	movement of cell or subce llular component	NAS	biological_process
GO:0007338	single fertilization	NAS	biological_process
GO:0007399	nervous system developmen t	NAS	biological_process
GO:0007519	skeletal muscle tissue de velopment	NAS	biological_process
GO:0008283	cell proliferation	NAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006928	movement of cell or subce llular component	NAS	biological_process
GO:0007338	single fertilization	NAS	biological_process
GO:0007399	nervous system developmen t	NAS	biological_process
GO:0007519	skeletal muscle tissue de velopment	NAS	biological_process
GO:0008283	cell proliferation	NAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0006928	movement of cell or subce llular component	NAS	biological_process
GO:0007338	single fertilization	NAS	biological_process
GO:0007399	nervous system developmen t	NAS	biological_process
GO:0007519	skeletal muscle tissue de velopment	NAS	biological_process
GO:0008283	cell proliferation	NAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	INFBASE28544021

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28544021	Endometrio sis						Show abstract