Endometriosis Knowledgebase

Search Result

Gene id

9370

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ADIPOQ Gene UCSC Ensembl

Aliases

ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28

Gene name

adiponectin, C1Q and collagen domain containing

Alternate names

adiponectin, 30 kDa adipocyte complement-related protein, adipocyte complement-related 30 kDa protein, adipose most abundant gene transcript 1 protein, adipose specific collagen-like factor, gelatin-binding protein 28,

Gene location

3q27.3 (186842673: 186858462) Exons: 4 NC_000003.12

Gene summary(Entrez)

This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010]

OMIM

605441

Protein Summary

Protein general information

Q15848

Name: Adiponectin (30 kDa adipocyte complement related protein) (Adipocyte complement related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain containing protein) (Adipose most abundant gene transcript 1 protein) (apM 1) (Gelatin binding protein)

Length: 244 Mass: 26,414

Tissue specificity: Synthesized exclusively by adipocytes and secreted into plasma.

Sequence

MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIG
PKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKF
HCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLY
ADNDNDSTFTGFLLYHDTN

Structural information

Protein Domains	Collagen-like (42-107) C1q. (108-244)
Interpro:	IPR001073 IPR008160 IPR008983
Prosite:	PS50871
Pfam:	PF00386 PF01391
PDB:	4DOU
PDBsum:	4DOU
STRING:	ENSP00000320709;

Other Databases

GeneCards: ADIPOQ; Malacards: ADIPOQ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0005102	receptor binding	ISS	molecular_function
GO:0005102	receptor binding	ISS	molecular_function
GO:0005125	cytokine activity	NAS	molecular_function
GO:0005179	hormone activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005581	collagen trimer	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0006006	glucose metabolic process	ISS	biological_process
GO:0006006	glucose metabolic process	ISS	biological_process
GO:0006091	generation of precursor m etabolites and energy	TAS	biological_process
GO:0006635	fatty acid beta-oxidation	ISS	biological_process
GO:0006635	fatty acid beta-oxidation	ISS	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0009744	response to sucrose	IEA	biological_process
GO:0009749	response to glucose	ISS	biological_process
GO:0009967	positive regulation of si gnal transduction	ISS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0010642	negative regulation of pl atelet-derived growth fac tor receptor signaling pa thway	IDA	biological_process
GO:0010739	positive regulation of pr otein kinase A signaling	IDA	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010804	negative regulation of tu mor necrosis factor-media ted signaling pathway	IDA	biological_process
GO:0010875	positive regulation of ch olesterol efflux	IDA	biological_process
GO:0010906	regulation of glucose met abolic process	IDA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014912	negative regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0019395	fatty acid oxidation	ISS	biological_process
GO:0030336	negative regulation of ce ll migration	ISS	biological_process
GO:0030853	negative regulation of gr anulocyte differentiation	IDA	biological_process
GO:0031953	negative regulation of pr otein autophosphorylation	IDA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0033034	positive regulation of my eloid cell apoptotic proc ess	IDA	biological_process
GO:0033211	adiponectin-activated sig naling pathway	IEA	biological_process
GO:0033691	sialic acid binding	IDA	molecular_function
GO:0034115	negative regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0034383	low-density lipoprotein p article clearance	IDA	biological_process
GO:0034612	response to tumor necrosi s factor	IDA	biological_process
GO:0035690	cellular response to drug	ISS	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042802	identical protein binding	TAS	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	ISS	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043407	negative regulation of MA P kinase activity	ISS	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IDA	biological_process
GO:0045650	negative regulation of ma crophage differentiation	IDA	biological_process
GO:0045715	negative regulation of lo w-density lipoprotein par ticle receptor biosynthet ic process	IDA	biological_process
GO:0045721	negative regulation of gl uconeogenesis	ISS	biological_process
GO:0045776	negative regulation of bl ood pressure	IDA	biological_process
GO:0045777	positive regulation of bl ood pressure	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045923	positive regulation of fa tty acid metabolic proces s	ISS	biological_process
GO:0046326	positive regulation of gl ucose import	ISS	biological_process
GO:0046888	negative regulation of ho rmone secretion	IEA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050728	negative regulation of in flammatory response	ISS	biological_process
GO:0050728	negative regulation of in flammatory response	NAS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050765	negative regulation of ph agocytosis	IDA	biological_process
GO:0050805	negative regulation of sy naptic transmission	IDA	biological_process
GO:0050873	brown fat cell differenti ation	ISS	biological_process
GO:0051260	protein homooligomerizati on	ISS	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051899	membrane depolarization	IEA	biological_process
GO:0060081	membrane hyperpolarizatio n	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070208	protein heterotrimerizati on	IEA	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070543	response to linoleic acid	IEA	biological_process
GO:0070994	detection of oxidative st ress	ISS	biological_process
GO:0071320	cellular response to cAMP	IEA	biological_process
GO:0071639	positive regulation of mo nocyte chemotactic protei n-1 production	IDA	biological_process
GO:0071872	cellular response to epin ephrine stimulus	IEA	biological_process
GO:0072659	protein localization to p lasma membrane	IDA	biological_process
GO:0090317	negative regulation of in tracellular protein trans port	IDA	biological_process
GO:1900121	negative regulation of re ceptor binding	IDA	biological_process
GO:2000279	negative regulation of DN A biosynthetic process	IDA	biological_process
GO:2000467	positive regulation of gl ycogen (starch) synthase activity	ISS	biological_process
GO:2000478	positive regulation of me tanephric glomerular visc eral epithelial cell deve lopment	ISS	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IDA	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IDA	biological_process
GO:2000534	positive regulation of re nal albumin absorption	IDA	biological_process
GO:2000584	negative regulation of pl atelet-derived growth fac tor receptor-alpha signal ing pathway	ISS	biological_process
GO:2000590	negative regulation of me tanephric mesenchymal cel l migration	ISS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005102	receptor binding	ISS	molecular_function
GO:0005102	receptor binding	ISS	molecular_function
GO:0005125	cytokine activity	NAS	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005581	collagen trimer	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0006006	glucose metabolic process	IEA	biological_process
GO:0006006	glucose metabolic process	ISS	biological_process
GO:0006006	glucose metabolic process	ISS	biological_process
GO:0006091	generation of precursor m etabolites and energy	TAS	biological_process
GO:0006635	fatty acid beta-oxidation	IEA	biological_process
GO:0006635	fatty acid beta-oxidation	ISS	biological_process
GO:0006635	fatty acid beta-oxidation	ISS	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0009744	response to sucrose	IEA	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0009749	response to glucose	ISS	biological_process
GO:0009967	positive regulation of si gnal transduction	IEA	biological_process
GO:0009967	positive regulation of si gnal transduction	ISS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0010642	negative regulation of pl atelet-derived growth fac tor receptor signaling pa thway	IEA	biological_process
GO:0010642	negative regulation of pl atelet-derived growth fac tor receptor signaling pa thway	IDA	biological_process
GO:0010739	positive regulation of pr otein kinase A signaling	IDA	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010804	negative regulation of tu mor necrosis factor-media ted signaling pathway	IDA	biological_process
GO:0010875	positive regulation of ch olesterol efflux	IDA	biological_process
GO:0010906	regulation of glucose met abolic process	IDA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014912	negative regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0019395	fatty acid oxidation	IEA	biological_process
GO:0019395	fatty acid oxidation	ISS	biological_process
GO:0030336	negative regulation of ce ll migration	IEA	biological_process
GO:0030336	negative regulation of ce ll migration	ISS	biological_process
GO:0030853	negative regulation of gr anulocyte differentiation	IDA	biological_process
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0031953	negative regulation of pr otein autophosphorylation	IDA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0033034	positive regulation of my eloid cell apoptotic proc ess	IDA	biological_process
GO:0033211	adiponectin-activated sig naling pathway	IEA	biological_process
GO:0033691	sialic acid binding	IDA	molecular_function
GO:0034115	negative regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0034383	low-density lipoprotein p article clearance	IDA	biological_process
GO:0034612	response to tumor necrosi s factor	IDA	biological_process
GO:0035690	cellular response to drug	IEA	biological_process
GO:0035690	cellular response to drug	ISS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042802	identical protein binding	IEA	molecular_function
GO:0042802	identical protein binding	TAS	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	ISS	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0043407	negative regulation of MA P kinase activity	IEA	biological_process
GO:0043407	negative regulation of MA P kinase activity	ISS	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IDA	biological_process
GO:0045650	negative regulation of ma crophage differentiation	IDA	biological_process
GO:0045715	negative regulation of lo w-density lipoprotein par ticle receptor biosynthet ic process	IDA	biological_process
GO:0045721	negative regulation of gl uconeogenesis	IEA	biological_process
GO:0045721	negative regulation of gl uconeogenesis	ISS	biological_process
GO:0045776	negative regulation of bl ood pressure	IDA	biological_process
GO:0045777	positive regulation of bl ood pressure	IEA	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045923	positive regulation of fa tty acid metabolic proces s	IEA	biological_process
GO:0045923	positive regulation of fa tty acid metabolic proces s	ISS	biological_process
GO:0046326	positive regulation of gl ucose import	IEA	biological_process
GO:0046326	positive regulation of gl ucose import	ISS	biological_process
GO:0046888	negative regulation of ho rmone secretion	IEA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050728	negative regulation of in flammatory response	IEA	biological_process
GO:0050728	negative regulation of in flammatory response	ISS	biological_process
GO:0050728	negative regulation of in flammatory response	NAS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050765	negative regulation of ph agocytosis	IDA	biological_process
GO:0050805	negative regulation of sy naptic transmission	IDA	biological_process
GO:0050873	brown fat cell differenti ation	IEA	biological_process
GO:0050873	brown fat cell differenti ation	ISS	biological_process
GO:0051260	protein homooligomerizati on	IEA	biological_process
GO:0051260	protein homooligomerizati on	ISS	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051899	membrane depolarization	IEA	biological_process
GO:0060081	membrane hyperpolarizatio n	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070208	protein heterotrimerizati on	IEA	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070543	response to linoleic acid	IEA	biological_process
GO:0070994	detection of oxidative st ress	IEA	biological_process
GO:0070994	detection of oxidative st ress	ISS	biological_process
GO:0071320	cellular response to cAMP	IEA	biological_process
GO:0071639	positive regulation of mo nocyte chemotactic protei n-1 production	IDA	biological_process
GO:0071872	cellular response to epin ephrine stimulus	IEA	biological_process
GO:0072659	protein localization to p lasma membrane	IDA	biological_process
GO:0090317	negative regulation of in tracellular protein trans port	IDA	biological_process
GO:1900121	negative regulation of re ceptor binding	IDA	biological_process
GO:2000279	negative regulation of DN A biosynthetic process	IDA	biological_process
GO:2000467	positive regulation of gl ycogen (starch) synthase activity	IEA	biological_process
GO:2000467	positive regulation of gl ycogen (starch) synthase activity	ISS	biological_process
GO:2000478	positive regulation of me tanephric glomerular visc eral epithelial cell deve lopment	IEA	biological_process
GO:2000478	positive regulation of me tanephric glomerular visc eral epithelial cell deve lopment	ISS	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IEA	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IDA	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IDA	biological_process
GO:2000534	positive regulation of re nal albumin absorption	IEA	biological_process
GO:2000534	positive regulation of re nal albumin absorption	IDA	biological_process
GO:2000584	negative regulation of pl atelet-derived growth fac tor receptor-alpha signal ing pathway	IEA	biological_process
GO:2000584	negative regulation of pl atelet-derived growth fac tor receptor-alpha signal ing pathway	ISS	biological_process
GO:2000590	negative regulation of me tanephric mesenchymal cel l migration	IEA	biological_process
GO:2000590	negative regulation of me tanephric mesenchymal cel l migration	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0005102	receptor binding	ISS	molecular_function
GO:0005102	receptor binding	ISS	molecular_function
GO:0005125	cytokine activity	NAS	molecular_function
GO:0005179	hormone activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0006006	glucose metabolic process	ISS	biological_process
GO:0006006	glucose metabolic process	ISS	biological_process
GO:0006091	generation of precursor m etabolites and energy	TAS	biological_process
GO:0006635	fatty acid beta-oxidation	ISS	biological_process
GO:0006635	fatty acid beta-oxidation	ISS	biological_process
GO:0009749	response to glucose	ISS	biological_process
GO:0009967	positive regulation of si gnal transduction	ISS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0010642	negative regulation of pl atelet-derived growth fac tor receptor signaling pa thway	IDA	biological_process
GO:0010739	positive regulation of pr otein kinase A signaling	IDA	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010804	negative regulation of tu mor necrosis factor-media ted signaling pathway	IDA	biological_process
GO:0010875	positive regulation of ch olesterol efflux	IDA	biological_process
GO:0010906	regulation of glucose met abolic process	IDA	biological_process
GO:0014912	negative regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0019395	fatty acid oxidation	ISS	biological_process
GO:0030336	negative regulation of ce ll migration	ISS	biological_process
GO:0030853	negative regulation of gr anulocyte differentiation	IDA	biological_process
GO:0031953	negative regulation of pr otein autophosphorylation	IDA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032869	cellular response to insu lin stimulus	ISS	biological_process
GO:0033034	positive regulation of my eloid cell apoptotic proc ess	IDA	biological_process
GO:0033691	sialic acid binding	IDA	molecular_function
GO:0034115	negative regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0034383	low-density lipoprotein p article clearance	IDA	biological_process
GO:0034612	response to tumor necrosi s factor	IDA	biological_process
GO:0035690	cellular response to drug	ISS	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042802	identical protein binding	TAS	molecular_function
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	ISS	biological_process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043407	negative regulation of MA P kinase activity	ISS	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IDA	biological_process
GO:0045650	negative regulation of ma crophage differentiation	IDA	biological_process
GO:0045715	negative regulation of lo w-density lipoprotein par ticle receptor biosynthet ic process	IDA	biological_process
GO:0045721	negative regulation of gl uconeogenesis	ISS	biological_process
GO:0045776	negative regulation of bl ood pressure	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045923	positive regulation of fa tty acid metabolic proces s	ISS	biological_process
GO:0046326	positive regulation of gl ucose import	ISS	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050728	negative regulation of in flammatory response	ISS	biological_process
GO:0050728	negative regulation of in flammatory response	NAS	biological_process
GO:0050765	negative regulation of ph agocytosis	IDA	biological_process
GO:0050805	negative regulation of sy naptic transmission	IDA	biological_process
GO:0050873	brown fat cell differenti ation	ISS	biological_process
GO:0051260	protein homooligomerizati on	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070994	detection of oxidative st ress	ISS	biological_process
GO:0071639	positive regulation of mo nocyte chemotactic protei n-1 production	IDA	biological_process
GO:0072659	protein localization to p lasma membrane	IDA	biological_process
GO:0090317	negative regulation of in tracellular protein trans port	IDA	biological_process
GO:1900121	negative regulation of re ceptor binding	IDA	biological_process
GO:2000279	negative regulation of DN A biosynthetic process	IDA	biological_process
GO:2000467	positive regulation of gl ycogen (starch) synthase activity	ISS	biological_process
GO:2000478	positive regulation of me tanephric glomerular visc eral epithelial cell deve lopment	ISS	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IDA	biological_process
GO:2000481	positive regulation of cA MP-dependent protein kina se activity	IDA	biological_process
GO:2000534	positive regulation of re nal albumin absorption	IDA	biological_process
GO:2000584	negative regulation of pl atelet-derived growth fac tor receptor-alpha signal ing pathway	ISS	biological_process
GO:2000590	negative regulation of me tanephric mesenchymal cel l migration	ISS	biological_process

KEGG pathways

hsa04932  Non-alcoholic fatty liver disease
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04930  Type II diabetes mellitus
hsa03320  PPAR signaling pathway

Diseases

Associated diseases	References
Adiponectin atherosclerosis	PMID: 16418740
Adiponectin deficiency	OMIM: 605441, KEGG: H00967
Anorexia nervosa	PMID: 16921786
Atherosclerosis	PMID: 15167446
Cancer	PMID: 16160698
Cardiovascular disease	PMID: 15167446
Cerebrovascular disease	PMID: 15167446
Chronic endometritis	PMID: 26952510
Diabetes	PMID: 11812766
Endometriosis	PMID: 20504092
Hyperandrogenism	PMID: 21190873
Hypertension	PMID: 15167446
Implantation failure	PMID: 26952510
Kidney disease	PMID: 14675060
Metabolic syndrome	PMID: 16418740
Nephropathy	PMID: 15334388
Obesity	PMID: 15583845
Pelvic endometriosis	PMID: 20504092
Polycystic ovary syndrome (PCOS)	PMID: 26699091
Polycystic ovary syndrome (PCOS)	PMID: 24530312
Preeclampsia	PMID: 16545001
Premature ovarian failure ( POF)	PMID: 19609224
Recurrent miscarriage	PMID: 26952510
Female infertility	INFBASE20504092
Pelvic endometriosis	INFBASE20504092
Endometriosis	INFBASE16055459

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16055459	Endometrio sis			78 (48 women wi th endometriosi s, 30 women wit hout endometrio sis)		Adiponectin	Show abstract
20504092	Endometrio sis (Pelvi c)			50 (15 endometr iosis, 35 no en dometriosis (co ntrols))		ADIPOQ LEP	Show abstract