Endometriosis Knowledgebase

Search Result

Gene id

9435

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CHST2 Gene UCSC Ensembl

Aliases

C6ST, GST-2, GST2, Gn6ST-1, HEL-S-75, glcNAc6ST-1

Gene name

carbohydrate sulfotransferase 2

Alternate names

carbohydrate sulfotransferase 2, N-acetylglucosamine 6-O-sulfotransferase 1, carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2, carbohydrate (chondroitin 6/keratan) sulfotransferase 2, epididymis secretory protein Li 75, galactose/N-acetylglucosamine/N,

Gene location

3q24 (143119775: 143124013) Exons: 2 NC_000003.12

Gene summary(Entrez)

This locus encodes a sulfotransferase protein. The encoded enzyme catalyzes the sulfation of a nonreducing N-acetylglucosamine residue, and may play a role in biosynthesis of 6-sulfosialyl Lewis X antigen. [provided by RefSeq, Aug 2011]

OMIM

603798

Protein Summary

Protein general information

Q9Y4C5

Name: Carbohydrate sulfotransferase 2 (EC 2.8.2. ) (Galactose/N acetylglucosamine/N acetylglucosamine 6 O sulfotransferase 2) (GST 2) (N acetylglucosamine 6 O sulfotransferase 1) (GlcNAc6ST 1) (Gn6ST 1)

Length: 530 Mass: 57,857

Tissue specificity: Widely expressed. Highly expressed in bone marrow, peripheral blood leukocytes, spleen, brain, spinal cord, ovary and placenta. Expressed by high endothelial cells (HEVs) and leukocytes. {ECO

Sequence

MSRSPQRALPPGALPRLLQAAPAAAPRALLPQWPRRPGRRWPASPLGMKVFRRKALVLCAGYALLLVLTMLNLLD
YKWHKEPLQQCNPDGPLGAAAGAAGGSWGRPGPPPAGPPRAHARLDLRTPYRPPAAAVGAAPAAAAGMAGVAAPP
GNGTRGTGGVGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSALYR
CDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRT
LVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHK
LGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPE
MEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLL
RKPRL

Structural information

Interpro:	IPR016469 IPR027417 IPR000863
Pfam:	PF00685
STRING:	ENSP00000307911;

Other Databases

GeneCards: CHST2; Malacards: CHST2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0001517	N-acetylglucosamine 6-O-s ulfotransferase activity	IDA	molecular_function
GO:0001517	N-acetylglucosamine 6-O-s ulfotransferase activity	IDA	molecular_function
GO:0001517	N-acetylglucosamine 6-O-s ulfotransferase activity	TAS	molecular_function
GO:0005802	trans-Golgi network	IDA	cellular_component
GO:0005975	carbohydrate metabolic pr ocess	IEA	biological_process
GO:0006044	N-acetylglucosamine metab olic process	IDA	biological_process
GO:0006790	sulfur compound metabolic process	IDA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008146	sulfotransferase activity	TAS	molecular_function
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0018146	keratan sulfate biosynthe tic process	TAS	biological_process
GO:0031228	intrinsic component of Go lgi membrane	NAS	cellular_component
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0001517	N-acetylglucosamine 6-O-s ulfotransferase activity	IDA	molecular_function
GO:0001517	N-acetylglucosamine 6-O-s ulfotransferase activity	IDA	molecular_function
GO:0001517	N-acetylglucosamine 6-O-s ulfotransferase activity	TAS	molecular_function
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005802	trans-Golgi network	IDA	cellular_component
GO:0005975	carbohydrate metabolic pr ocess	IEA	biological_process
GO:0005975	carbohydrate metabolic pr ocess	IEA	biological_process
GO:0006044	N-acetylglucosamine metab olic process	IDA	biological_process
GO:0006790	sulfur compound metabolic process	IDA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008146	sulfotransferase activity	IEA	molecular_function
GO:0008146	sulfotransferase activity	IEA	molecular_function
GO:0008146	sulfotransferase activity	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016740	transferase activity	IEA	molecular_function
GO:0018146	keratan sulfate biosynthe tic process	TAS	biological_process
GO:0031228	intrinsic component of Go lgi membrane	NAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0001517	N-acetylglucosamine 6-O-s ulfotransferase activity	IDA	molecular_function
GO:0001517	N-acetylglucosamine 6-O-s ulfotransferase activity	IDA	molecular_function
GO:0001517	N-acetylglucosamine 6-O-s ulfotransferase activity	TAS	molecular_function
GO:0005802	trans-Golgi network	IDA	cellular_component
GO:0006044	N-acetylglucosamine metab olic process	IDA	biological_process
GO:0006790	sulfur compound metabolic process	IDA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008146	sulfotransferase activity	TAS	molecular_function
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0018146	keratan sulfate biosynthe tic process	TAS	biological_process
GO:0031228	intrinsic component of Go lgi membrane	NAS	cellular_component

KEGG pathways

hsa00533 Glycosaminoglycan biosynthesis - keratan sulfate

Diseases

Associated diseases	References
Endometriosis	PMID: 12810542
Hearing loss	PMID: 19898482
Female infertility	INFBASE12810542
Implantation defects	INFBASE12810542
Endometriosis	INFBASE12810542

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12810542	Endometrio sis					IL-15 proline-rich protein B61 Dickkopf-1 glycodelin N-acetylglucosamine-6-O-sulfotransferase G0S2 protein purine nucleoside phosphorylase semaphorin E neuronal olfactomedin-related endoplasmic reticulum localized protein mRNA Sam68-like phospho	Show abstract