Endometriosis Knowledgebase

Search Result

Gene id

948

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CD36 Gene UCSC Ensembl

Aliases

BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3

Gene name

CD36 molecule

Alternate names

platelet glycoprotein 4, CD36 antigen (collagen type I receptor, thrombospondin receptor), CD36 molecule (thrombospondin receptor), GPIIIB, PAS IV, PAS-4 protein, cluster determinant 36, fatty acid translocase, glycoprotein IIIb, leukocyte differentiation antigen ,

Gene location

7q21.11 (80602187: 80679276) Exons: 18 NC_000007.14

Gene summary(Entrez)

The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2014]

OMIM

173510

Protein Summary

Protein general information

P16671

Name: Platelet glycoprotein 4 (Fatty acid translocase) (FAT) (Glycoprotein IIIb) (GPIIIB) (Leukocyte differentiation antigen CD36) (PAS IV) (PAS 4) (Platelet collagen receptor) (Platelet glycoprotein IV) (GPIV) (Thrombospondin receptor) (CD antigen CD36)

Length: 472 Mass: 53,053

Sequence

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQE
VMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQ
NQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVA
IIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAF
ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEP
ITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLS
VGVVMFVAFMISYCACRSKTIK

Structural information

Interpro:	IPR005428 IPR033076 IPR002159
Pfam:	PF01130
PDB:	5LGD
PDBsum:	5LGD
STRING:	ENSP00000308165;

Other Databases

GeneCards: CD36; Malacards: CD36

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IDA	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0005041	low-density lipoprotein r eceptor activity	IMP	molecular_function
GO:0005041	low-density lipoprotein r eceptor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006629	lipid metabolic process	NAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006910	phagocytosis, recognition	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0007263	nitric oxide mediated sig nal transduction	IDA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008035	high-density lipoprotein particle binding	IEA	molecular_function
GO:0008289	lipid binding	IDA	molecular_function
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	ISS	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010744	positive regulation of ma crophage derived foam cel l differentiation	IMP	biological_process
GO:0010886	positive regulation of ch olesterol storage	IEA	biological_process
GO:0016020	membrane	TAS	cellular_component
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0019915	lipid storage	IMP	biological_process
GO:0019934	cGMP-mediated signaling	IDA	biological_process
GO:0030169	low-density lipoprotein p article binding	IDA	molecular_function
GO:0030194	positive regulation of bl ood coagulation	IEA	biological_process
GO:0030299	intestinal cholesterol ab sorption	ISS	biological_process
GO:0030301	cholesterol transport	ISS	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0031092	platelet alpha granule me mbrane	TAS	cellular_component
GO:0031526	brush border membrane	ISS	cellular_component
GO:0031623	receptor internalization	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0033993	response to lipid	ISS	biological_process
GO:0034197	triglyceride transport	ISS	biological_process
GO:0034381	plasma lipoprotein partic le clearance	ISS	biological_process
GO:0034383	low-density lipoprotein p article clearance	IMP	biological_process
GO:0035634	response to stilbenoid	IEA	biological_process
GO:0038124	toll-like receptor TLR6:T LR2 signaling pathway	TAS	biological_process
GO:0042953	lipoprotein transport	IMP	biological_process
GO:0042953	lipoprotein transport	TAS	biological_process
GO:0042992	negative regulation of tr anscription factor import into nucleus	IEA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0043277	apoptotic cell clearance	IEA	biological_process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological_process
GO:0044539	long-chain fatty acid imp ort	IDA	biological_process
GO:0044539	long-chain fatty acid imp ort	IDA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045335	phagocytic vesicle	TAS	cellular_component
GO:0050431	transforming growth facto r beta binding	ISS	molecular_function
GO:0050702	interleukin-1 beta secret ion	ISS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IEA	biological_process
GO:0050892	intestinal absorption	ISS	biological_process
GO:0050909	sensory perception of tas te	ISS	biological_process
GO:0055096	low-density lipoprotein p article mediated signalin g	IEA	biological_process
GO:0060100	positive regulation of ph agocytosis, engulfment	IEA	biological_process
GO:0060907	positive regulation of ma crophage cytokine product ion	IEA	biological_process
GO:0070053	thrombospondin receptor a ctivity	ISS	molecular_function
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070508	cholesterol import	ISS	biological_process
GO:0070542	response to fatty acid	ISS	biological_process
GO:0070543	response to linoleic acid	ISS	biological_process
GO:0070892	lipoteichoic acid recepto r activity	IEA	molecular_function
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071223	cellular response to lipo teichoic acid	IEA	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:0071447	cellular response to hydr operoxide	IEA	biological_process
GO:0071726	cellular response to diac yl bacterial lipopeptide	IDA	biological_process
GO:0071813	lipoprotein particle bind ing	IDA	molecular_function
GO:1900227	positive regulation of NL RP3 inflammasome complex assembly	ISS	biological_process
GO:1990000	amyloid fibril formation	ISS	biological_process
GO:2000121	regulation of removal of superoxide radicals	IEA	biological_process
GO:2000334	positive regulation of bl ood microparticle formati on	IEA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IEA	biological_process
GO:2000505	regulation of energy home ostasis	ISS	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IDA	biological_process
GO:0002221	pattern recognition recep tor signaling pathway	IEA	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0005041	low-density lipoprotein r eceptor activity	IEA	molecular_function
GO:0005041	low-density lipoprotein r eceptor activity	IMP	molecular_function
GO:0005041	low-density lipoprotein r eceptor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006629	lipid metabolic process	NAS	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006910	phagocytosis, recognition	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0007263	nitric oxide mediated sig nal transduction	IDA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008035	high-density lipoprotein particle binding	IEA	molecular_function
GO:0008289	lipid binding	IDA	molecular_function
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	ISS	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010744	positive regulation of ma crophage derived foam cel l differentiation	IEA	biological_process
GO:0010744	positive regulation of ma crophage derived foam cel l differentiation	IMP	biological_process
GO:0010886	positive regulation of ch olesterol storage	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0019915	lipid storage	IEA	biological_process
GO:0019915	lipid storage	IMP	biological_process
GO:0019934	cGMP-mediated signaling	IDA	biological_process
GO:0030169	low-density lipoprotein p article binding	IEA	molecular_function
GO:0030169	low-density lipoprotein p article binding	IDA	molecular_function
GO:0030194	positive regulation of bl ood coagulation	IEA	biological_process
GO:0030299	intestinal cholesterol ab sorption	IEA	biological_process
GO:0030299	intestinal cholesterol ab sorption	ISS	biological_process
GO:0030301	cholesterol transport	IEA	biological_process
GO:0030301	cholesterol transport	ISS	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0031092	platelet alpha granule me mbrane	TAS	cellular_component
GO:0031526	brush border membrane	IEA	cellular_component
GO:0031526	brush border membrane	ISS	cellular_component
GO:0031623	receptor internalization	IEA	biological_process
GO:0031623	receptor internalization	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0033993	response to lipid	IEA	biological_process
GO:0033993	response to lipid	ISS	biological_process
GO:0034197	triglyceride transport	IEA	biological_process
GO:0034197	triglyceride transport	ISS	biological_process
GO:0034381	plasma lipoprotein partic le clearance	IEA	biological_process
GO:0034381	plasma lipoprotein partic le clearance	ISS	biological_process
GO:0034383	low-density lipoprotein p article clearance	IEA	biological_process
GO:0034383	low-density lipoprotein p article clearance	IMP	biological_process
GO:0035634	response to stilbenoid	IEA	biological_process
GO:0038124	toll-like receptor TLR6:T LR2 signaling pathway	TAS	biological_process
GO:0042953	lipoprotein transport	IEA	biological_process
GO:0042953	lipoprotein transport	IMP	biological_process
GO:0042953	lipoprotein transport	TAS	biological_process
GO:0042992	negative regulation of tr anscription factor import into nucleus	IEA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0043277	apoptotic cell clearance	IEA	biological_process
GO:0043410	positive regulation of MA PK cascade	IEA	biological_process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological_process
GO:0044539	long-chain fatty acid imp ort	IEA	biological_process
GO:0044539	long-chain fatty acid imp ort	IDA	biological_process
GO:0044539	long-chain fatty acid imp ort	IDA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045121	membrane raft	IEA	cellular_component
GO:0045121	membrane raft	IDA	cellular_component
GO:0045177	apical part of cell	IEA	cellular_component
GO:0045335	phagocytic vesicle	TAS	cellular_component
GO:0050431	transforming growth facto r beta binding	ISS	molecular_function
GO:0050702	interleukin-1 beta secret ion	IEA	biological_process
GO:0050702	interleukin-1 beta secret ion	ISS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IEA	biological_process
GO:0050892	intestinal absorption	IEA	biological_process
GO:0050892	intestinal absorption	ISS	biological_process
GO:0050909	sensory perception of tas te	IEA	biological_process
GO:0050909	sensory perception of tas te	ISS	biological_process
GO:0055096	low-density lipoprotein p article mediated signalin g	IEA	biological_process
GO:0060100	positive regulation of ph agocytosis, engulfment	IEA	biological_process
GO:0060907	positive regulation of ma crophage cytokine product ion	IEA	biological_process
GO:0070053	thrombospondin receptor a ctivity	ISS	molecular_function
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070508	cholesterol import	IEA	biological_process
GO:0070508	cholesterol import	ISS	biological_process
GO:0070542	response to fatty acid	IEA	biological_process
GO:0070542	response to fatty acid	ISS	biological_process
GO:0070543	response to linoleic acid	IEA	biological_process
GO:0070543	response to linoleic acid	ISS	biological_process
GO:0070892	lipoteichoic acid recepto r activity	IEA	molecular_function
GO:0071221	cellular response to bact erial lipopeptide	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071223	cellular response to lipo teichoic acid	IEA	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	IEA	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:0071447	cellular response to hydr operoxide	IEA	biological_process
GO:0071726	cellular response to diac yl bacterial lipopeptide	IDA	biological_process
GO:0071813	lipoprotein particle bind ing	IDA	molecular_function
GO:1900227	positive regulation of NL RP3 inflammasome complex assembly	IEA	biological_process
GO:1900227	positive regulation of NL RP3 inflammasome complex assembly	ISS	biological_process
GO:1990000	amyloid fibril formation	IEA	biological_process
GO:1990000	amyloid fibril formation	ISS	biological_process
GO:2000121	regulation of removal of superoxide radicals	IEA	biological_process
GO:2000334	positive regulation of bl ood microparticle formati on	IEA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IEA	biological_process
GO:2000505	regulation of energy home ostasis	IEA	biological_process
GO:2000505	regulation of energy home ostasis	ISS	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IDA	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0005041	low-density lipoprotein r eceptor activity	IMP	molecular_function
GO:0005041	low-density lipoprotein r eceptor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006629	lipid metabolic process	NAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	ISS	biological_process
GO:0007263	nitric oxide mediated sig nal transduction	IDA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008289	lipid binding	IDA	molecular_function
GO:0009986	cell surface	ISS	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010744	positive regulation of ma crophage derived foam cel l differentiation	IMP	biological_process
GO:0016020	membrane	TAS	cellular_component
GO:0019915	lipid storage	IMP	biological_process
GO:0019934	cGMP-mediated signaling	IDA	biological_process
GO:0030169	low-density lipoprotein p article binding	IDA	molecular_function
GO:0030299	intestinal cholesterol ab sorption	ISS	biological_process
GO:0030301	cholesterol transport	ISS	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0031092	platelet alpha granule me mbrane	TAS	cellular_component
GO:0031526	brush border membrane	ISS	cellular_component
GO:0031623	receptor internalization	ISS	biological_process
GO:0033993	response to lipid	ISS	biological_process
GO:0034197	triglyceride transport	ISS	biological_process
GO:0034381	plasma lipoprotein partic le clearance	ISS	biological_process
GO:0034383	low-density lipoprotein p article clearance	IMP	biological_process
GO:0038124	toll-like receptor TLR6:T LR2 signaling pathway	TAS	biological_process
GO:0042953	lipoprotein transport	IMP	biological_process
GO:0042953	lipoprotein transport	TAS	biological_process
GO:0044539	long-chain fatty acid imp ort	IDA	biological_process
GO:0044539	long-chain fatty acid imp ort	IDA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045335	phagocytic vesicle	TAS	cellular_component
GO:0050431	transforming growth facto r beta binding	ISS	molecular_function
GO:0050702	interleukin-1 beta secret ion	ISS	biological_process
GO:0050892	intestinal absorption	ISS	biological_process
GO:0050909	sensory perception of tas te	ISS	biological_process
GO:0070053	thrombospondin receptor a ctivity	ISS	molecular_function
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070508	cholesterol import	ISS	biological_process
GO:0070542	response to fatty acid	ISS	biological_process
GO:0070543	response to linoleic acid	ISS	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:0071726	cellular response to diac yl bacterial lipopeptide	IDA	biological_process
GO:0071813	lipoprotein particle bind ing	IDA	molecular_function
GO:1900227	positive regulation of NL RP3 inflammasome complex assembly	ISS	biological_process
GO:1990000	amyloid fibril formation	ISS	biological_process
GO:2000505	regulation of energy home ostasis	ISS	biological_process

KEGG pathways

hsa04145  Phagosome
hsa04640  Hematopoietic cell lineage
hsa04152  AMPK signaling pathway
hsa04931  Insulin resistance
hsa05144  Malaria
hsa04920  Adipocytokine signaling pathway
hsa04512  ECM-receptor interaction
hsa03320  PPAR signaling pathway
hsa04975  Fat digestion and absorption

Diseases

Associated diseases	References
Anemia	PMID: 19413744
Atherosclerosis	PMID: 15167446
Cancer	PMID: 15780035
CD36 deficiency	KEGG: H01108
Coronary heart disease	OMIM: 173510
Diabetes	PMID: 16911630
Endometrial cancer	PMID: 22351475
Endometriosis	PMID: 19606481
Kidney disease	PMID: 19578796
Macrothrombocytopenia	OMIM: 173510
Obesity	PMID: 19016618
Osteoarthritis	PMID: 16453284
Platelet glycoprotein IV deficiency	OMIM: 173510
Polycystic ovary syndrome (PCOS)	PMID: 15498184
Endometriosis	INFBASE19606481

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19606481	Endometrio sis					CD36	Show abstract