Endometriosis Knowledgebase

Search Result

Gene id

949

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SCARB1 Gene UCSC Ensembl

Aliases

CD36L1, CLA-1, CLA1, HDLQTL6, SR-BI, SRB1

Gene name

scavenger receptor class B member 1

Alternate names

scavenger receptor class B member 1, CD36 and LIMPII analogous 1, CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1, scavenger receptor class B type III,

Gene location

12q24.31 (124863972: 124777627) Exons: 13 NC_000012.12

Gene summary(Entrez)

The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2011]

OMIM

601040

Protein Summary

Protein general information

Q8WTV0

Name: Scavenger receptor class B member 1 (SRB1) (CD36 and LIMPII analogous 1) (CLA 1) (CD36 antigen like 1) (Collagen type I receptor, thrombospondin receptor like 1) (SR BI) (CD antigen CD36)

Length: 552 Mass: 60,878

Tissue specificity: Widely expressed.

Sequence

MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNP
SEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMEN
KPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGV
QNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR
FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEAHSLFLDIH
PVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVLLA
LGCVLLLVPVICQIRSQVGAGQRAARADSHSLACWGKGASDRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTL
ASFACRVATTLPVLEGLGPSLGGGTGS

Structural information

Interpro:	IPR005428 IPR002159
Pfam:	PF01130
MINT:	5001419
STRING:	ENSP00000261693;

Other Databases

GeneCards: SCARB1; Malacards: SCARB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001530	lipopolysaccharide bindin g	IDA	molecular_function
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001786	phosphatidylserine bindin g	ISS	molecular_function
GO:0001875	lipopolysaccharide recept or activity	IDA	molecular_function
GO:0001935	endothelial cell prolifer ation	IEA	biological_process
GO:0005215	transporter activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005545	1-phosphatidylinositol bi nding	TAS	molecular_function
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005901	caveola	TAS	cellular_component
GO:0006702	androgen biosynthetic pro cess	IEA	biological_process
GO:0006707	cholesterol catabolic pro cess	IEA	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0008035	high-density lipoprotein particle binding	IEA	molecular_function
GO:0009986	cell surface	ISS	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	TAS	biological_process
GO:0010867	positive regulation of tr iglyceride biosynthetic p rocess	ISS	biological_process
GO:0010886	positive regulation of ch olesterol storage	IDA	biological_process
GO:0010899	regulation of phosphatidy lcholine catabolic proces s	ISS	biological_process
GO:0015914	phospholipid transport	ISS	biological_process
GO:0015920	lipopolysaccharide transp ort	IDA	biological_process
GO:0030169	low-density lipoprotein p article binding	IDA	molecular_function
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0031528	microvillus membrane	IEA	cellular_component
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IEA	biological_process
GO:0032497	detection of lipopolysacc haride	IDA	biological_process
GO:0033344	cholesterol efflux	IMP	biological_process
GO:0033344	cholesterol efflux	ISS	biological_process
GO:0034185	apolipoprotein binding	IPI	molecular_function
GO:0034186	apolipoprotein A-I bindin g	IPI	molecular_function
GO:0034186	apolipoprotein A-I bindin g	IPI	molecular_function
GO:0034375	high-density lipoprotein particle remodeling	ISS	biological_process
GO:0034383	low-density lipoprotein p article clearance	ISS	biological_process
GO:0034384	high-density lipoprotein particle clearance	IDA	biological_process
GO:0035461	vitamin transmembrane tra nsport	IMP	biological_process
GO:0042060	wound healing	TAS	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042632	cholesterol homeostasis	ISS	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043534	blood vessel endothelial cell migration	IEA	biological_process
GO:0043654	recognition of apoptotic cell	IDA	biological_process
GO:0043691	reverse cholesterol trans port	IEP	biological_process
GO:0044406	adhesion of symbiont to h ost	IMP	biological_process
GO:0046718	viral entry into host cel l	IEA	biological_process
GO:0050764	regulation of phagocytosi s	IC	biological_process
GO:0050892	intestinal absorption	IEA	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070328	triglyceride homeostasis	ISS	biological_process
GO:0070506	high-density lipoprotein particle receptor activit y	IMP	molecular_function
GO:0070506	high-density lipoprotein particle receptor activit y	IDA	molecular_function
GO:0070508	cholesterol import	ISS	biological_process
GO:0070508	cholesterol import	IMP	biological_process
GO:0070508	cholesterol import	ISS	biological_process
GO:0001530	lipopolysaccharide bindin g	IDA	molecular_function
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001786	phosphatidylserine bindin g	IEA	molecular_function
GO:0001786	phosphatidylserine bindin g	ISS	molecular_function
GO:0001875	lipopolysaccharide recept or activity	IDA	molecular_function
GO:0001935	endothelial cell prolifer ation	IEA	biological_process
GO:0005215	transporter activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005545	1-phosphatidylinositol bi nding	TAS	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005901	caveola	IEA	cellular_component
GO:0005901	caveola	IEA	cellular_component
GO:0005901	caveola	TAS	cellular_component
GO:0006702	androgen biosynthetic pro cess	IEA	biological_process
GO:0006707	cholesterol catabolic pro cess	IEA	biological_process
GO:0006869	lipid transport	IEA	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006910	phagocytosis, recognition	IEA	biological_process
GO:0008035	high-density lipoprotein particle binding	IEA	molecular_function
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	ISS	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	TAS	biological_process
GO:0010867	positive regulation of tr iglyceride biosynthetic p rocess	IEA	biological_process
GO:0010867	positive regulation of tr iglyceride biosynthetic p rocess	ISS	biological_process
GO:0010886	positive regulation of ch olesterol storage	IDA	biological_process
GO:0010899	regulation of phosphatidy lcholine catabolic proces s	IEA	biological_process
GO:0010899	regulation of phosphatidy lcholine catabolic proces s	ISS	biological_process
GO:0015914	phospholipid transport	IEA	biological_process
GO:0015914	phospholipid transport	ISS	biological_process
GO:0015920	lipopolysaccharide transp ort	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0030169	low-density lipoprotein p article binding	IDA	molecular_function
GO:0030301	cholesterol transport	IEA	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0031528	microvillus membrane	IEA	cellular_component
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IEA	biological_process
GO:0032497	detection of lipopolysacc haride	IDA	biological_process
GO:0033344	cholesterol efflux	IEA	biological_process
GO:0033344	cholesterol efflux	IMP	biological_process
GO:0033344	cholesterol efflux	ISS	biological_process
GO:0034185	apolipoprotein binding	IEA	molecular_function
GO:0034185	apolipoprotein binding	IPI	molecular_function
GO:0034186	apolipoprotein A-I bindin g	IPI	molecular_function
GO:0034186	apolipoprotein A-I bindin g	IPI	molecular_function
GO:0034375	high-density lipoprotein particle remodeling	IEA	biological_process
GO:0034375	high-density lipoprotein particle remodeling	ISS	biological_process
GO:0034383	low-density lipoprotein p article clearance	IEA	biological_process
GO:0034383	low-density lipoprotein p article clearance	ISS	biological_process
GO:0034384	high-density lipoprotein particle clearance	IDA	biological_process
GO:0035461	vitamin transmembrane tra nsport	IMP	biological_process
GO:0042060	wound healing	TAS	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042632	cholesterol homeostasis	IEA	biological_process
GO:0042632	cholesterol homeostasis	ISS	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043534	blood vessel endothelial cell migration	IEA	biological_process
GO:0043654	recognition of apoptotic cell	IEA	biological_process
GO:0043654	recognition of apoptotic cell	IDA	biological_process
GO:0043691	reverse cholesterol trans port	IEA	biological_process
GO:0043691	reverse cholesterol trans port	IEP	biological_process
GO:0044406	adhesion of symbiont to h ost	IMP	biological_process
GO:0046718	viral entry into host cel l	IEA	biological_process
GO:0050764	regulation of phagocytosi s	IEA	biological_process
GO:0050764	regulation of phagocytosi s	IC	biological_process
GO:0050892	intestinal absorption	IEA	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070328	triglyceride homeostasis	IEA	biological_process
GO:0070328	triglyceride homeostasis	ISS	biological_process
GO:0070506	high-density lipoprotein particle receptor activit y	IMP	molecular_function
GO:0070506	high-density lipoprotein particle receptor activit y	IDA	molecular_function
GO:0070508	cholesterol import	IEA	biological_process
GO:0070508	cholesterol import	ISS	biological_process
GO:0070508	cholesterol import	IMP	biological_process
GO:0070508	cholesterol import	ISS	biological_process
GO:0001530	lipopolysaccharide bindin g	IDA	molecular_function
GO:0001786	phosphatidylserine bindin g	ISS	molecular_function
GO:0001875	lipopolysaccharide recept or activity	IDA	molecular_function
GO:0005215	transporter activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005545	1-phosphatidylinositol bi nding	TAS	molecular_function
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005901	caveola	TAS	cellular_component
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0009986	cell surface	ISS	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	TAS	biological_process
GO:0010867	positive regulation of tr iglyceride biosynthetic p rocess	ISS	biological_process
GO:0010886	positive regulation of ch olesterol storage	IDA	biological_process
GO:0010899	regulation of phosphatidy lcholine catabolic proces s	ISS	biological_process
GO:0015914	phospholipid transport	ISS	biological_process
GO:0015920	lipopolysaccharide transp ort	IDA	biological_process
GO:0030169	low-density lipoprotein p article binding	IDA	molecular_function
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0032497	detection of lipopolysacc haride	IDA	biological_process
GO:0033344	cholesterol efflux	IMP	biological_process
GO:0033344	cholesterol efflux	ISS	biological_process
GO:0034185	apolipoprotein binding	IPI	molecular_function
GO:0034186	apolipoprotein A-I bindin g	IPI	molecular_function
GO:0034186	apolipoprotein A-I bindin g	IPI	molecular_function
GO:0034375	high-density lipoprotein particle remodeling	ISS	biological_process
GO:0034383	low-density lipoprotein p article clearance	ISS	biological_process
GO:0034384	high-density lipoprotein particle clearance	IDA	biological_process
GO:0035461	vitamin transmembrane tra nsport	IMP	biological_process
GO:0042060	wound healing	TAS	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042632	cholesterol homeostasis	ISS	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043654	recognition of apoptotic cell	IDA	biological_process
GO:0043691	reverse cholesterol trans port	IEP	biological_process
GO:0044406	adhesion of symbiont to h ost	IMP	biological_process
GO:0050764	regulation of phagocytosi s	IC	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070328	triglyceride homeostasis	ISS	biological_process
GO:0070506	high-density lipoprotein particle receptor activit y	IMP	molecular_function
GO:0070506	high-density lipoprotein particle receptor activit y	IDA	molecular_function
GO:0070508	cholesterol import	ISS	biological_process
GO:0070508	cholesterol import	IMP	biological_process
GO:0070508	cholesterol import	ISS	biological_process

KEGG pathways

hsa04145  Phagosome
hsa05160  Hepatitis C
hsa04913  Ovarian steroidogenesis
hsa04925  Aldosterone synthesis and secretion
hsa04976  Bile secretion
hsa04975  Fat digestion and absorption
hsa04977  Vitamin digestion and absorption

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 12555245
Atherosclerosis	PMID: 15681296
Cancer	PMID: 21131975
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Coronary artery disease	PMID: 12227853
Diabetes	PMID: 19276229
Endometriosis	PMID: 11502834
Female infertility	PMID: 21531995
Hypercholesterolemia	PMID: 12417285
Hyperlipoproteinemia	PMID: 19158204
Macular degeneration	PMID: 19806217
Endometriosis	INFBASE11502834
Obesity	PMID: 12568179
Premature ovarian failure ( POF)	PMID: 27301361

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11502834	Endometrio sis					SCARB1 CYP19A1	Show abstract