Endometriosis Knowledgebase

Search Result

Gene id

9547

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CXCL14 Gene UCSC Ensembl

Aliases

BMAC, BRAK, KEC, KS1, MIP-2g, MIP2G, NJAC, SCYB14

Gene name

C-X-C motif chemokine ligand 14

Alternate names

C-X-C motif chemokine 14, CXC chemokine in breast and kidney, MIP-2 gamma, bolekine, breast and kidney, chemokine (C-X-C motif) ligand 14, chemokine BRAK, small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK), small-inducible cytokine B14, tumor-suppr,

Gene location

5q31.1 (135579278: 135570678) Exons: 4 NC_000005.10

Gene summary(Entrez)

This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq, Sep 2014]

OMIM

604186

Protein Summary

Protein general information

O95715

Name: C X C motif chemokine 14 (Chemokine BRAK) (MIP 2G) (Small inducible cytokine B14)

Length: 111 Mass: 13,078

Tissue specificity: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derive

Sequence

MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSV
SRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Structural information

Motifs	D-box. (67-81)
Interpro:	IPR001811
Pfam:	PF00048
PDB:	2HDL
PDBsum:	2HDL
DIP:	61148
MINT:	4724169
STRING:	ENSP00000337065;

Other Databases

GeneCards: CXCL14; Malacards: CXCL14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IEA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0045662	negative regulation of my oblast differentiation	IEA	biological_process
GO:0048839	inner ear development	IEA	biological_process
GO:0060326	cell chemotaxis	IEA	biological_process
GO:2000503	positive regulation of na tural killer cell chemota xis	IEA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	TAS	molecular_function
GO:0045662	negative regulation of my oblast differentiation	IEA	biological_process
GO:0048839	inner ear development	IEA	biological_process
GO:0060326	cell chemotaxis	IEA	biological_process
GO:2000503	positive regulation of na tural killer cell chemota xis	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	TAS	molecular_function

KEGG pathways

hsa04060 Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Cancer	PMID: 16175604
Endometriosis	PMID: 24292148
Endometriosis	INFBASE24292148

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24292148	Endometrio sis			47 (Microarray study: 10 infer tile women with endometriosis, 5 fertile cont rols; qRT-PCR ( 27 infertile wo men with endome triosis, 15 fer tile controls))			Show abstract