Endometriosis Knowledgebase

Search Result

Gene id

9588

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PRDX6 Gene UCSC Ensembl

Aliases

1-Cys, AOP2, HEL-S-128m, NSGPx, PRX, aiPLA2, p29

Gene name

peroxiredoxin 6

Alternate names

peroxiredoxin-6, 1-Cys PRX, 1-Cys peroxiredoxin, 24 kDa protein, acidic calcium-independent phospholipase A2, antioxidant protein 2, epididymis secretory sperm binding protein Li 128m, liver 2D page spot 40, non-selenium glutathione peroxidase, red blood cells pag,

Gene location

1q25.1 (173477346: 173488806) Exons: 5 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. [provided by RefSeq, Jul 2008]

OMIM

602316

Protein Summary

Protein general information

P30041

Name: Peroxiredoxin 6 (EC 1.11.1.15) (1 Cys peroxiredoxin) (1 Cys PRX) (24 kDa protein) (Acidic calcium independent phospholipase A2) (aiPLA2) (EC 3.1.1. ) (Antioxidant protein 2) (Liver 2D page spot 40) (Non selenium glutathione peroxidase) (NSGPx) (EC 1.11.1.

Length: 224 Mass: 25,035

Sequence

MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDS
VEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYP
ATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

Structural information

Protein Domains	Thioredoxin. (5-169)
Interpro:	IPR000866 IPR024706 IPR019479 IPR012336 IPR013766
Prosite:	PS51352
Pfam:	PF10417 PF00578
PDB:	1PRX 5B6M 5B6N
PDBsum:	1PRX 5B6M 5B6N
MINT:	4999165
STRING:	ENSP00000342026;

Other Databases

GeneCards: PRDX6; Malacards: PRDX6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000302	response to reactive oxyg en species	TAS	biological_process
GO:0004602	glutathione peroxidase ac tivity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016042	lipid catabolic process	IEA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0042744	hydrogen peroxide catabol ic process	IEA	biological_process
GO:0051920	peroxiredoxin activity	IEA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0000302	response to reactive oxyg en species	TAS	biological_process
GO:0003824	catalytic activity	IEA	molecular_function
GO:0004601	peroxidase activity	IEA	molecular_function
GO:0004602	glutathione peroxidase ac tivity	IEA	molecular_function
GO:0004602	glutathione peroxidase ac tivity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0008152	metabolic process	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016042	lipid catabolic process	IEA	biological_process
GO:0016209	antioxidant activity	IEA	molecular_function
GO:0016209	antioxidant activity	IEA	molecular_function
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0042744	hydrogen peroxide catabol ic process	IEA	biological_process
GO:0051920	peroxiredoxin activity	IEA	molecular_function
GO:0051920	peroxiredoxin activity	IEA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:0000302	response to reactive oxyg en species	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa01100 Metabolic pathways

Diseases

Associated diseases	References
Endometriosis	PMID: 20199104
Endometriosis	INFBASE20199104

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20199104	Endometrio sis				Female infertility	PRDX6 CORO1A TAGLN2 VIM CFTR GCR HSF1	Show abstract