Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 9588
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol PRDX6   Gene   UCSC   Ensembl
Aliases 1-Cys, AOP2, HEL-S-128m, NSGPx, PRX, aiPLA2, p29
Gene name peroxiredoxin 6
Alternate names peroxiredoxin-6, 1-Cys PRX, 1-Cys peroxiredoxin, 24 kDa protein, acidic calcium-independent phospholipase A2, antioxidant protein 2, epididymis secretory sperm binding protein Li 128m, liver 2D page spot 40, non-selenium glutathione peroxidase, red blood cells pag,
Gene location 1q25.1 (173477346: 173488806)     Exons: 5     NC_000001.11
Gene summary(Entrez) The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. [provided by RefSeq, Jul 2008]
OMIM 602316

Protein Summary

Protein general information P30041  

Name: Peroxiredoxin 6 (EC 1.11.1.15) (1 Cys peroxiredoxin) (1 Cys PRX) (24 kDa protein) (Acidic calcium independent phospholipase A2) (aiPLA2) (EC 3.1.1. ) (Antioxidant protein 2) (Liver 2D page spot 40) (Non selenium glutathione peroxidase) (NSGPx) (EC 1.11.1.

Length: 224  Mass: 25,035

Sequence MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDS
VEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYP
ATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Structural information
Protein Domains
Thioredoxin. (5-169)
Interpro:  IPR000866 IPR024706 IPR019479 IPR012336 IPR013766
Prosite:   PS51352

Pfam:  
PF10417 PF00578

PDB:  
1PRX 5B6M 5B6N
PDBsum:   1PRX 5B6M 5B6N
MINT:   4999165
STRING:   ENSP00000342026;
Other Databases GeneCards:  PRDX6;  Malacards:  PRDX6

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000302 response to reactive oxyg
en species
TAS biological_process
GO:0004602 glutathione peroxidase ac
tivity
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005764 lysosome
IEA cellular_component
GO:0005829 cytosol
NAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0016020 membrane
IDA cellular_component
GO:0016042 lipid catabolic process
IEA biological_process
GO:0016787 hydrolase activity
IEA molecular_function
GO:0031625 ubiquitin protein ligase
binding
IPI molecular_function
GO:0042744 hydrogen peroxide catabol
ic process
IEA biological_process
GO:0051920 peroxiredoxin activity
IEA molecular_function
GO:0055114 oxidation-reduction proce
ss
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0098869 cellular oxidant detoxifi
cation
IEA biological_process
GO:0000302 response to reactive oxyg
en species
TAS biological_process
GO:0003824 catalytic activity
IEA molecular_function
GO:0004601 peroxidase activity
IEA molecular_function
GO:0004602 glutathione peroxidase ac
tivity
IEA molecular_function
GO:0004602 glutathione peroxidase ac
tivity
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005764 lysosome
IEA cellular_component
GO:0005764 lysosome
IEA cellular_component
GO:0005829 cytosol
NAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006629 lipid metabolic process
IEA biological_process
GO:0008152 metabolic process
IEA biological_process
GO:0016020 membrane
IDA cellular_component
GO:0016042 lipid catabolic process
IEA biological_process
GO:0016209 antioxidant activity
IEA molecular_function
GO:0016209 antioxidant activity
IEA molecular_function
GO:0016491 oxidoreductase activity
IEA molecular_function
GO:0016491 oxidoreductase activity
IEA molecular_function
GO:0016787 hydrolase activity
IEA molecular_function
GO:0031410 cytoplasmic vesicle
IEA cellular_component
GO:0031625 ubiquitin protein ligase
binding
IPI molecular_function
GO:0042744 hydrogen peroxide catabol
ic process
IEA biological_process
GO:0051920 peroxiredoxin activity
IEA molecular_function
GO:0051920 peroxiredoxin activity
IEA molecular_function
GO:0055114 oxidation-reduction proce
ss
IEA biological_process
GO:0055114 oxidation-reduction proce
ss
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0098869 cellular oxidant detoxifi
cation
IEA biological_process
GO:0000302 response to reactive oxyg
en species
TAS biological_process
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005829 cytosol
NAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0016020 membrane
IDA cellular_component
GO:0031625 ubiquitin protein ligase
binding
IPI molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component

KEGG pathways

hsa01100  Metabolic pathways

Diseases

Associated diseases References
Endometriosis PMID: 20199104
Endometriosis INFBASE20199104

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
20199104 Endometrio
sis


Female infertility PRDX6
CORO1A
TAGLN2
VIM
CFTR
GCR
HSF1
Show abstract