Endometriosis Knowledgebase

Search Result

Gene id

960

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CD44 Gene UCSC Ensembl

Aliases

CDW44, CSPG8, ECMR-III, HCELL, HUTCH-I, IN, LHR, MC56, MDU2, MDU3, MIC4, Pgp1

Gene name

CD44 molecule (Indian blood group)

Alternate names

CD44 antigen, GP90 lymphocyte homing/adhesion receptor, Hermes antigen, cell surface glycoprotein CD44, chondroitin sulfate proteoglycan 8, epican, extracellular matrix receptor III, hematopoietic cell E- and L-selectin ligand, heparan sulfate proteoglycan, homing,

Gene location

11p13 (35138869: 35232401) Exons: 21 NC_000011.10

Gene summary(Entrez)

The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis. [provided by RefSeq, Jul 2008]

OMIM

107269

Protein Summary

Protein general information

P16070

Name: CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP 1) (Phagocytic glycop

Length: 742 Mass: 81,538

Tissue specificity: Isoform 10 (epithelial isoform) is expressed by cells of epithelium and highly expressed by carcinomas. Expression is repressed in neuroblastoma cells.

Sequence

MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFE
TCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNR
DGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLM
STSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD
EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEE
EETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSW
TDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKD
HPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR
SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRR
CGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV

Structural information

Protein Domains	Link. (32-120)
Interpro:	IPR016186 IPR001231 IPR016187 IPR000538
Prosite:	PS01241 PS50963
Pfam:	PF00193
PDB:	1POZ 1UUH 2I83 4PZ3 4PZ4
PDBsum:	1POZ 1UUH 2I83 4PZ3 4PZ4
DIP:	1121
MINT:	5000740
STRING:	ENSP00000398632;

Other Databases

GeneCards: CD44; Malacards: CD44

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	NAS	molecular_function
GO:0005540	hyaluronic acid binding	IDA	molecular_function
GO:0005540	hyaluronic acid binding	IDA	molecular_function
GO:0005540	hyaluronic acid binding	NAS	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007160	cell-matrix adhesion	NAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016337	single organismal cell-ce ll adhesion	NAS	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030214	hyaluronan catabolic proc ess	IDA	biological_process
GO:0030214	hyaluronan catabolic proc ess	TAS	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	IMP	biological_process
GO:0035692	macrophage migration inhi bitory factor receptor co mplex	IDA	cellular_component
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IMP	biological_process
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051216	cartilage development	IEP	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070487	monocyte aggregation	IMP	biological_process
GO:1900625	positive regulation of mo nocyte aggregation	IMP	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	IDA	biological_process
GO:0004896	cytokine receptor activit y	IDA	molecular_function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	NAS	molecular_function
GO:0005540	hyaluronic acid binding	IEA	molecular_function
GO:0005540	hyaluronic acid binding	IDA	molecular_function
GO:0005540	hyaluronic acid binding	IDA	molecular_function
GO:0005540	hyaluronic acid binding	NAS	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007160	cell-matrix adhesion	NAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016337	single organismal cell-ce ll adhesion	NAS	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030214	hyaluronan catabolic proc ess	IDA	biological_process
GO:0030214	hyaluronan catabolic proc ess	TAS	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	IMP	biological_process
GO:0035692	macrophage migration inhi bitory factor receptor co mplex	IDA	cellular_component
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IMP	biological_process
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051216	cartilage development	IEP	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070487	monocyte aggregation	IMP	biological_process
GO:1900625	positive regulation of mo nocyte aggregation	IMP	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	IDA	biological_process
GO:0004896	cytokine receptor activit y	IDA	molecular_function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	NAS	molecular_function
GO:0005540	hyaluronic acid binding	IDA	molecular_function
GO:0005540	hyaluronic acid binding	IDA	molecular_function
GO:0005540	hyaluronic acid binding	NAS	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007160	cell-matrix adhesion	NAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016337	single organismal cell-ce ll adhesion	NAS	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030214	hyaluronan catabolic proc ess	IDA	biological_process
GO:0030214	hyaluronan catabolic proc ess	TAS	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	IMP	biological_process
GO:0035692	macrophage migration inhi bitory factor receptor co mplex	IDA	cellular_component
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IMP	biological_process
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051216	cartilage development	IEP	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070487	monocyte aggregation	IMP	biological_process
GO:1900625	positive regulation of mo nocyte aggregation	IMP	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	IDA	biological_process
GO:0004896	cytokine receptor activit y	IDA	molecular_function

KEGG pathways

hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
hsa05169  Epstein-Barr virus infection
hsa04640  Hematopoietic cell lineage
hsa04512  ECM-receptor interaction
hsa05131  Shigellosis
PTHR10225:SF6  Alzheimer disease-presenilin pathway
PTHR10225:SF6  Alzheimer disease-presenilin pathway

Diseases

Associated diseases	References
Adenomyosis	PMID: 7680356
Arthritis	PMID: 11981324
Cleft lip	PMID: 16415175
Ectopic endometrial implants	PMID: 1400884
Endometriosis	PMID: 23639674
Gastric cancer	KEGG: H00018
Lupus erythematosus	PMID: 12215908
Male hypogonadism	PMID: 18508780
Malfunction of oocytes	PMID: 22260850
Ovarian endometriosis	PMID: 9647570
Ovarian endometriosis	PMID: 14556838
Ovarian endometriosis	PMID: 14556838
Ovarian hyperstimulation syndrome (OHSS)	PMID: 17074323
Polycystic ovary syndrome (PCOS)	PMID: 22007253
Primary amenorrhea	PMID: 9626144
Ovarian endometriosis	INFBASE14556838
Endometriosis	INFBASE11293159
Unexplained infertility	PMID: 22007253

PubMed references

PMID	Condition	Mutation	Population details	Associated_genes	Abstract
23639674	Endometrio sis		32 (13 endometr iosis lesions, 11 isolated end ometriotic-like cells (IELC)-p ositive pelvic sentinel lymph nodes (PSLN), 8 ELC-negative P SLN))	EPCAM CDH1 (E-cadherin) CXCR4 CD44	Show abstract
25711649	Endometrio sis		169 (39 PF and serum samples f rom normal heal thy and 130 sam ples from diffe rent stages of patients with e ndometriosis (3 3 cases of stag e I, 38 stage I I, 30 stage III and 29 stage I V))		Show abstract
19200980	Endometrio sis	CD44 splice variant		CD44	Show abstract
17919613	Endometrio sis			CD44	Show abstract
11293159	Endometrio sis		25 patients(16 proliferative, 9 secretory (N = 9) stages)	CD44	Show abstract
11966474	Endometrio sis		51 (6 endometri um samples, 7 p eritoneal endom etriotic sample s, 15 endometri um by immunohis tochemistry, 23 peritoneal end ometriotic samp les)	CD44	Show abstract
14556838	Endometrio sis (ovari an)			CD44	Show abstract