Endometriosis Knowledgebase

Search Result

Gene id

972

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CD74 Gene UCSC Ensembl

Aliases

DHLAG, HLADG, II, Ia-GAMMA

Gene name

CD74 molecule

Alternate names

HLA class II histocompatibility antigen gamma chain, CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated), CD74 molecule, major histocompatibility complex, class II invariant chain, HLA-DR antigens-associated ,

Gene location

5q33.1 (150412935: 150401636) Exons: 9 NC_000005.10

Gene summary(Entrez)

The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]

OMIM

142790

Protein Summary

Protein general information

P04233

Name: HLA class II histocompatibility antigen gamma chain (HLA DR antigens associated invariant chain) (Ia antigen associated invariant chain) (Ii) (p33) (CD antigen CD74)

Length: 296 Mass: 33,516

Sequence

MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQ
GRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNAD
PLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHP
GSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM

Structural information

Protein Domains	Thyroglobulin (210-271)
Interpro:	IPR015386 IPR022339 IPR011988 IPR000716
Prosite:	PS00484 PS51162
Pfam:	PF09307 PF08831 PF00086
PDB:	1A6A 1ICF 1IIE 1L3H 1MUJ 3PDO 3PGC 3PGD 3QXA 3QXD 4AEN 4AH2 4X5W
PDBsum:	1A6A 1ICF 1IIE 1L3H 1MUJ 3PDO 3PGC 3PGD 3QXA 3QXD 4AEN 4AH2 4X5W
MINT:	1488574
STRING:	ENSP00000009530;

Other Databases

GeneCards: CD74; Malacards: CD74

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000187	activation of MAPK activi ty	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IDA	biological_process
GO:0001540	beta-amyloid binding	IPI	molecular_function
GO:0001961	positive regulation of cy tokine-mediated signaling pathway	IMP	biological_process
GO:0002606	positive regulation of de ndritic cell antigen proc essing and presentation	IEA	biological_process
GO:0002792	negative regulation of pe ptide secretion	IDA	biological_process
GO:0002830	positive regulation of ty pe 2 immune response	IEA	biological_process
GO:0002906	negative regulation of ma ture B cell apoptotic pro cess	IEA	biological_process
GO:0004896	cytokine receptor activit y	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005771	multivesicular body	IEA	cellular_component
GO:0005773	vacuole	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006461	protein complex assembly	ISS	biological_process
GO:0006886	intracellular protein tra nsport	ISS	biological_process
GO:0006952	defense response	IEA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0008283	cell proliferation	IDA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0016064	immunoglobulin mediated i mmune response	ISS	biological_process
GO:0019883	antigen processing and pr esentation of endogenous antigen	NAS	biological_process
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	TAS	biological_process
GO:0019955	cytokine binding	IPI	molecular_function
GO:0019955	cytokine binding	IPI	molecular_function
GO:0023026	MHC class II protein comp lex binding	IDA	molecular_function
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0030890	positive regulation of B cell proliferation	IMP	biological_process
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0035691	macrophage migration inhi bitory factor signaling p athway	IEA	biological_process
GO:0035692	macrophage migration inhi bitory factor receptor co mplex	IDA	cellular_component
GO:0035693	NOS2-CD74 complex	IEA	cellular_component
GO:0035718	macrophage migration inhi bitory factor binding	IPI	molecular_function
GO:0042289	MHC class II protein bind ing	ISS	molecular_function
GO:0042289	MHC class II protein bind ing	NAS	molecular_function
GO:0042658	MHC class II protein bind ing, via antigen binding groove	IDA	molecular_function
GO:0042802	identical protein binding	TAS	molecular_function
GO:0043030	regulation of macrophage activation	NAS	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0044183	protein binding involved in protein folding	IDA	molecular_function
GO:0045058	T cell selection	NAS	biological_process
GO:0045059	positive thymic T cell se lection	IEA	biological_process
GO:0045060	negative thymic T cell se lection	IEA	biological_process
GO:0045581	negative regulation of T cell differentiation	IEA	biological_process
GO:0045582	positive regulation of T cell differentiation	IEA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050998	nitric-oxide synthase bin ding	IEA	molecular_function
GO:0051085	chaperone mediated protei n folding requiring cofac tor	IEA	biological_process
GO:0060907	positive regulation of ma crophage cytokine product ion	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0090023	positive regulation of ne utrophil chemotaxis	ISS	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	IMP	biological_process
GO:2000343	positive regulation of ch emokine (C-X-C motif) lig and 2 production	ISS	biological_process
GO:0042613	MHC class II protein comp lex	ISS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000187	activation of MAPK activi ty	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IDA	biological_process
GO:0001540	beta-amyloid binding	IPI	molecular_function
GO:0001961	positive regulation of cy tokine-mediated signaling pathway	IEA	biological_process
GO:0001961	positive regulation of cy tokine-mediated signaling pathway	IMP	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002606	positive regulation of de ndritic cell antigen proc essing and presentation	IEA	biological_process
GO:0002792	negative regulation of pe ptide secretion	IDA	biological_process
GO:0002830	positive regulation of ty pe 2 immune response	IEA	biological_process
GO:0002906	negative regulation of ma ture B cell apoptotic pro cess	IEA	biological_process
GO:0004896	cytokine receptor activit y	IEA	molecular_function
GO:0004896	cytokine receptor activit y	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	TAS	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005770	late endosome	IEA	cellular_component
GO:0005771	multivesicular body	IEA	cellular_component
GO:0005773	vacuole	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006461	protein complex assembly	IEA	biological_process
GO:0006461	protein complex assembly	ISS	biological_process
GO:0006886	intracellular protein tra nsport	IEA	biological_process
GO:0006886	intracellular protein tra nsport	IEA	biological_process
GO:0006886	intracellular protein tra nsport	ISS	biological_process
GO:0006952	defense response	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0008283	cell proliferation	IEA	biological_process
GO:0008283	cell proliferation	IDA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0016064	immunoglobulin mediated i mmune response	IEA	biological_process
GO:0016064	immunoglobulin mediated i mmune response	ISS	biological_process
GO:0019882	antigen processing and pr esentation	IEA	biological_process
GO:0019882	antigen processing and pr esentation	IEA	biological_process
GO:0019883	antigen processing and pr esentation of endogenous antigen	NAS	biological_process
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	IEA	biological_process
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	TAS	biological_process
GO:0019955	cytokine binding	IEA	molecular_function
GO:0019955	cytokine binding	IPI	molecular_function
GO:0019955	cytokine binding	IPI	molecular_function
GO:0023026	MHC class II protein comp lex binding	IDA	molecular_function
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0030890	positive regulation of B cell proliferation	IMP	biological_process
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0035691	macrophage migration inhi bitory factor signaling p athway	IEA	biological_process
GO:0035692	macrophage migration inhi bitory factor receptor co mplex	IEA	cellular_component
GO:0035692	macrophage migration inhi bitory factor receptor co mplex	IDA	cellular_component
GO:0035693	NOS2-CD74 complex	IEA	cellular_component
GO:0035718	macrophage migration inhi bitory factor binding	IPI	molecular_function
GO:0042289	MHC class II protein bind ing	IEA	molecular_function
GO:0042289	MHC class II protein bind ing	IEA	molecular_function
GO:0042289	MHC class II protein bind ing	ISS	molecular_function
GO:0042289	MHC class II protein bind ing	NAS	molecular_function
GO:0042613	MHC class II protein comp lex	IEA	cellular_component
GO:0042658	MHC class II protein bind ing, via antigen binding groove	IDA	molecular_function
GO:0042802	identical protein binding	TAS	molecular_function
GO:0043030	regulation of macrophage activation	NAS	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IEA	biological_process
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0044183	protein binding involved in protein folding	IDA	molecular_function
GO:0045058	T cell selection	NAS	biological_process
GO:0045059	positive thymic T cell se lection	IEA	biological_process
GO:0045060	negative thymic T cell se lection	IEA	biological_process
GO:0045581	negative regulation of T cell differentiation	IEA	biological_process
GO:0045582	positive regulation of T cell differentiation	IEA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050998	nitric-oxide synthase bin ding	IEA	molecular_function
GO:0051085	chaperone mediated protei n folding requiring cofac tor	IEA	biological_process
GO:0060907	positive regulation of ma crophage cytokine product ion	IEA	biological_process
GO:0060907	positive regulation of ma crophage cytokine product ion	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0090023	positive regulation of ne utrophil chemotaxis	IEA	biological_process
GO:0090023	positive regulation of ne utrophil chemotaxis	ISS	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	IEA	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	IMP	biological_process
GO:2000343	positive regulation of ch emokine (C-X-C motif) lig and 2 production	IEA	biological_process
GO:2000343	positive regulation of ch emokine (C-X-C motif) lig and 2 production	ISS	biological_process
GO:0042613	MHC class II protein comp lex	ISS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0001516	prostaglandin biosyntheti c process	IDA	biological_process
GO:0001540	beta-amyloid binding	IPI	molecular_function
GO:0001961	positive regulation of cy tokine-mediated signaling pathway	IMP	biological_process
GO:0002792	negative regulation of pe ptide secretion	IDA	biological_process
GO:0004896	cytokine receptor activit y	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005773	vacuole	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006461	protein complex assembly	ISS	biological_process
GO:0006886	intracellular protein tra nsport	ISS	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0008283	cell proliferation	IDA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0016064	immunoglobulin mediated i mmune response	ISS	biological_process
GO:0019883	antigen processing and pr esentation of endogenous antigen	NAS	biological_process
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	TAS	biological_process
GO:0019955	cytokine binding	IPI	molecular_function
GO:0019955	cytokine binding	IPI	molecular_function
GO:0023026	MHC class II protein comp lex binding	IDA	molecular_function
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0030890	positive regulation of B cell proliferation	IMP	biological_process
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0035692	macrophage migration inhi bitory factor receptor co mplex	IDA	cellular_component
GO:0035718	macrophage migration inhi bitory factor binding	IPI	molecular_function
GO:0042289	MHC class II protein bind ing	ISS	molecular_function
GO:0042289	MHC class II protein bind ing	NAS	molecular_function
GO:0042658	MHC class II protein bind ing, via antigen binding groove	IDA	molecular_function
GO:0042802	identical protein binding	TAS	molecular_function
GO:0043030	regulation of macrophage activation	NAS	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043518	negative regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0044183	protein binding involved in protein folding	IDA	molecular_function
GO:0045058	T cell selection	NAS	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0060907	positive regulation of ma crophage cytokine product ion	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0090023	positive regulation of ne utrophil chemotaxis	ISS	biological_process
GO:1902166	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage by p53 class mediator	IMP	biological_process
GO:2000343	positive regulation of ch emokine (C-X-C motif) lig and 2 production	ISS	biological_process
GO:0042613	MHC class II protein comp lex	ISS	cellular_component

KEGG pathways

hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa04612  Antigen processing and presentation

Diseases

Associated diseases	References
Celiac disease	PMID: 19845895
Endometriosis	PMID: 25439837
Endometriosis	INFBASE25439837

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25439837	Endometrio sis			36 (16 normal c ontrols, 20 wom en with endomet riosis)	Female infertility	MIF CD74 and COX-2	Show abstract