Endometriosis Knowledgebase

Search Result

Gene id

9770

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

RASSF2 Gene UCSC Ensembl

Aliases

CENP-34, RASFADIN

Gene name

Ras association domain family member 2

Alternate names

ras association domain-containing protein 2, Ras association (RalGDS/AF-6) domain family 2, Ras association (RalGDS/AF-6) domain family member 2, centromere protein 34,

Gene location

20p13 (4823667: 4780022) Exons: 15 NC_000020.11

Gene summary(Entrez)

This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by RefSeq, Jul 2008]

OMIM

609492

Protein Summary

Protein general information

P50749

Name: Ras association domain containing protein 2

Length: 326 Mass: 37,790

Tissue specificity: Widely expressed with highest levels in brain, placenta, peripheral blood and lung. Frequently down-regulated in lung tumor cell lines. {ECO

Sequence

MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQMQDDNE
RIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVR
RRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYV
VHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKK
LMRKYTVLRLMIRQRLEEIAETPATI

Structural information

Protein Domains	Ras-associating. (176-264) SARAH. (272-319)
Interpro:	IPR033614 IPR000159 IPR033618 IPR011524 IPR029071
Prosite:	PS50200 PS50951
Pfam:	PF16517 PF00788
MINT:	6773106
STRING:	ENSP00000368684;

Other Databases

GeneCards: RASSF2; Malacards: RASSF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001501	skeletal system developme nt	IEA	biological_process
GO:0001503	ossification	IEA	biological_process
GO:0004672	protein kinase activity	IGI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0031954	positive regulation of pr otein autophosphorylation	IDA	biological_process
GO:0033137	negative regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0038168	epidermal growth factor r eceptor signaling pathway via I-kappaB kinase/NF-k appaB cascade	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0045667	regulation of osteoblast differentiation	IEA	biological_process
GO:0045670	regulation of osteoclast differentiation	IEA	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0046849	bone remodeling	IEA	biological_process
GO:0048872	homeostasis of number of cells	IEA	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:1901223	negative regulation of NI K/NF-kappaB signaling	IEA	biological_process
GO:0001501	skeletal system developme nt	IEA	biological_process
GO:0001503	ossification	IEA	biological_process
GO:0004672	protein kinase activity	IGI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0031954	positive regulation of pr otein autophosphorylation	IDA	biological_process
GO:0033137	negative regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0038168	epidermal growth factor r eceptor signaling pathway via I-kappaB kinase/NF-k appaB cascade	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0045667	regulation of osteoblast differentiation	IEA	biological_process
GO:0045670	regulation of osteoclast differentiation	IEA	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0046849	bone remodeling	IEA	biological_process
GO:0048872	homeostasis of number of cells	IEA	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:1901222	regulation of NIK/NF-kapp aB signaling	IEA	biological_process
GO:1901223	negative regulation of NI K/NF-kappaB signaling	IEA	biological_process
GO:0004672	protein kinase activity	IGI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0031954	positive regulation of pr otein autophosphorylation	IDA	biological_process
GO:0033137	negative regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0045860	positive regulation of pr otein kinase activity	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0050821	protein stabilization	IMP	biological_process

KEGG pathways

hsa04392 Hippo signaling pathway -multiple species

Diseases

Associated diseases	References
Endometriosis (ovarian)	PMID: 25298284
Endometriosis-associated ovarian carcinoma, Ovarian endometrioid cancer (OEC) and ovarian clear cell cancer (OCCC)	INFBASE25298284
Ovarian endometriosis	INFBASE25298284
Ovarian endometriosis	PMID: 25298284

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25298284	Endometrio sis (ovari an)			50 (30 EMS-asso ciated ovarian carcinoma (18 O varian endometr ioid cancer, 12 ovarian clear cell cancer), 2 0 normal endome trial specimens )		RASSF2 RUNX3 GSTZ1 CYP2A GBGT1 NDUFS1 SPOCK2 ADAM22 and TRIM36	Show abstract