Endometriosis Knowledgebase

Search Result

Gene id

999

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CDH1 Gene UCSC Ensembl

Aliases

Arc-1, CD324, CDHE, ECAD, LCAM, UVO

Gene name

cadherin 1

Alternate names

cadherin-1, CAM 120/80, E-cadherin 1, cadherin 1, E-cadherin (epithelial), cadherin 1, type 1, E-cadherin (epithelial), calcium-dependent adhesion protein, epithelial, cell-CAM 120/80, epithelial cadherin, uvomorulin,

Gene location

16q22.1 (68737289: 68835541) Exons: 18 NC_000016.10

Gene summary(Entrez)

This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function of this gene is thought to contribute to cancer progression by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. This gene is present in a gene cluster with other members of the cadherin family on chromosome 16. [provided by RefSeq, Nov 2015]

OMIM

192090

SNPs

rs1801026

Strand: +   Allele origin: unknown  Allele change: A/C/G/T   Mutation type: snp


NC_000016.10   g.68833553C>T
NC_000016.9   g.68867456C>T
NG_008021.1   g.101262C>T
NM_001317184.1   c.*54C>T
NM_001317185.1   c.*54C>T
NM_001317186.1   c.*54C>T
NM_004360.4   c.*54C>T
NM_004360.3   c.*54C>T
XM_005256272.1   c.*54C>T
XM_011523489.1   c.*54C>T
XM_011523488.1
Clinical Significance: Benign

rs4783689

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000678.2   g.68819768C>T
NC_000016.10   g.68819768C>T
NC_000016.9   g.68853671C>T
NG_008021.1   g.87477C>T
NM_001317184.1   c.1528+343C>T
NM_001317185.1   c.163+343C>T
NM_001317186.1   c.-254-2233C>T
NM_004360.3   c.1711+343C>T
NM_004360.4   c.1711+343C>T
rs5030625

Strand:    Allele origin:   Allele change: -/A   Mutation type: in-del

CM000678.2   g.68736944delA
NC_000016.10   g.68736944delA
NC_000016.9   g.68770847delA
NG_008021.1   g.4653delA
NM_001317184.1   c.-472delA
NM_001317185.1   c.-2087delA
NM_001317186.1   c.-2291delA
NM_004360.4   c.-472delA

Protein Summary

Protein general information

P12830

Name: Cadherin 1 (CAM 120/80) (Epithelial cadherin) (E cadherin) (Uvomorulin) (CD antigen CD324) [Cleaved into: E Cad/CTF1; E Cad/CTF2; E Cad/CTF3]

Length: 882 Mass: 97,456

Tissue specificity: Non-neural epithelial tissues.

Sequence

MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRF
KVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLR
RQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERI
ATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIF
NPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQY
ILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRI
WRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNK
DQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRD
NVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAP
PYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD

Structural information

Protein Domains	Cadherin (155-262) Cadherin (263-375) Cadherin (376-486) Cadherin (487-593)
Interpro:	IPR002126 IPR015919 IPR020894 IPR000233 IPR014868 IPR027397
Prosite:	PS00232 PS50268
Pfam:	PF00028 PF01049 PF08758
PDB:	1O6S 2O72 2OMT 2OMU 2OMV 2OMX 2OMY 2OMZ 3FF7 3FF8 3L6X 3L6Y 4ZT1 4ZTE
PDBsum:	1O6S 2O72 2OMT 2OMU 2OMV 2OMX 2OMY 2OMZ 3FF7 3FF8 3L6X 3L6Y 4ZT1 4ZTE
DIP:	477
MINT:	119105
STRING:	ENSP00000261769;

Other Databases

GeneCards: CDH1; Malacards: CDH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005802	trans-Golgi network	IMP	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005913	cell-cell adherens juncti on	IDA	cellular_component
GO:0005913	cell-cell adherens juncti on	IDA	cellular_component
GO:0005913	cell-cell adherens juncti on	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	NAS	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	NAS	biological_process
GO:0007416	synapse assembly	IEA	biological_process
GO:0008013	beta-catenin binding	IDA	molecular_function
GO:0009636	response to toxic substan ce	IEA	biological_process
GO:0009898	cytoplasmic side of plasm a membrane	IDA	cellular_component
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0016235	aggresome	IDA	cellular_component
GO:0016328	lateral plasma membrane	IDA	cellular_component
GO:0016328	lateral plasma membrane	IDA	cellular_component
GO:0016337	single organismal cell-ce ll adhesion	IDA	biological_process
GO:0016337	single organismal cell-ce ll adhesion	IDA	biological_process
GO:0016342	catenin complex	IDA	cellular_component
GO:0016600	flotillin complex	IDA	cellular_component
GO:0021983	pituitary gland developme nt	IEA	biological_process
GO:0022408	negative regulation of ce ll-cell adhesion	IMP	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030027	lamellipodium	IDA	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030506	ankyrin binding	IPI	molecular_function
GO:0031175	neuron projection develop ment	IEA	biological_process
GO:0032794	GTPase activating protein binding	IPI	molecular_function
GO:0034332	adherens junction organiz ation	IMP	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042993	positive regulation of tr anscription factor import into nucleus	IDA	biological_process
GO:0043296	apical junction complex	IDA	cellular_component
GO:0045295	gamma-catenin binding	IPI	molecular_function
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050839	cell adhesion molecule bi nding	NAS	molecular_function
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071285	cellular response to lith ium ion	IDA	biological_process
GO:0071681	cellular response to indo le-3-methanol	IDA	biological_process
GO:0072659	protein localization to p lasma membrane	IDA	biological_process
GO:0090002	establishment of protein localization to plasma me mbrane	IMP	biological_process
GO:0030864	cortical actin cytoskelet on	IDA	cellular_component
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005802	trans-Golgi network	IMP	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005913	cell-cell adherens juncti on	IDA	cellular_component
GO:0005913	cell-cell adherens juncti on	IDA	cellular_component
GO:0005913	cell-cell adherens juncti on	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IEA	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	NAS	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	NAS	biological_process
GO:0007416	synapse assembly	IEA	biological_process
GO:0008013	beta-catenin binding	IDA	molecular_function
GO:0009636	response to toxic substan ce	IEA	biological_process
GO:0009898	cytoplasmic side of plasm a membrane	IDA	cellular_component
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0016235	aggresome	IDA	cellular_component
GO:0016328	lateral plasma membrane	IDA	cellular_component
GO:0016328	lateral plasma membrane	IDA	cellular_component
GO:0016337	single organismal cell-ce ll adhesion	IDA	biological_process
GO:0016337	single organismal cell-ce ll adhesion	IDA	biological_process
GO:0016342	catenin complex	IDA	cellular_component
GO:0016600	flotillin complex	IDA	cellular_component
GO:0021983	pituitary gland developme nt	IEA	biological_process
GO:0022408	negative regulation of ce ll-cell adhesion	IMP	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030027	lamellipodium	IDA	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030506	ankyrin binding	IPI	molecular_function
GO:0031175	neuron projection develop ment	IEA	biological_process
GO:0032794	GTPase activating protein binding	IPI	molecular_function
GO:0034332	adherens junction organiz ation	IMP	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042993	positive regulation of tr anscription factor import into nucleus	IDA	biological_process
GO:0043296	apical junction complex	IDA	cellular_component
GO:0045295	gamma-catenin binding	IPI	molecular_function
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050839	cell adhesion molecule bi nding	NAS	molecular_function
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071285	cellular response to lith ium ion	IDA	biological_process
GO:0071681	cellular response to indo le-3-methanol	IDA	biological_process
GO:0072659	protein localization to p lasma membrane	IDA	biological_process
GO:0090002	establishment of protein localization to plasma me mbrane	IMP	biological_process
GO:0030864	cortical actin cytoskelet on	IDA	cellular_component
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005802	trans-Golgi network	IMP	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005913	cell-cell adherens juncti on	IDA	cellular_component
GO:0005913	cell-cell adherens juncti on	IDA	cellular_component
GO:0005913	cell-cell adherens juncti on	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	NAS	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	NAS	biological_process
GO:0008013	beta-catenin binding	IDA	molecular_function
GO:0009898	cytoplasmic side of plasm a membrane	IDA	cellular_component
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0016235	aggresome	IDA	cellular_component
GO:0016328	lateral plasma membrane	IDA	cellular_component
GO:0016328	lateral plasma membrane	IDA	cellular_component
GO:0016337	single organismal cell-ce ll adhesion	IDA	biological_process
GO:0016337	single organismal cell-ce ll adhesion	IDA	biological_process
GO:0016342	catenin complex	IDA	cellular_component
GO:0016600	flotillin complex	IDA	cellular_component
GO:0022408	negative regulation of ce ll-cell adhesion	IMP	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030027	lamellipodium	IDA	cellular_component
GO:0030054	cell junction	TAS	cellular_component
GO:0030054	cell junction	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030506	ankyrin binding	IPI	molecular_function
GO:0032794	GTPase activating protein binding	IPI	molecular_function
GO:0034332	adherens junction organiz ation	IMP	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042993	positive regulation of tr anscription factor import into nucleus	IDA	biological_process
GO:0043296	apical junction complex	IDA	cellular_component
GO:0045295	gamma-catenin binding	IPI	molecular_function
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050839	cell adhesion molecule bi nding	NAS	molecular_function
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071285	cellular response to lith ium ion	IDA	biological_process
GO:0071681	cellular response to indo le-3-methanol	IDA	biological_process
GO:0072659	protein localization to p lasma membrane	IDA	biological_process
GO:0090002	establishment of protein localization to plasma me mbrane	IMP	biological_process
GO:0030864	cortical actin cytoskelet on	IDA	cellular_component

KEGG pathways

hsa05200  Pathways in cancer
hsa04015  Rap1 signaling pathway
hsa04514  Cell adhesion molecules
hsa04390  Hippo signaling pathway
hsa04371  Apelin signaling pathway
hsa05218  Melanoma
hsa04520  Adherens junction
hsa05219  Bladder cancer
hsa05213  Endometrial cancer
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05216  Thyroid cancer

Diseases

Associated diseases	References
Adenomyosis	PMID: 19137776
Cancer	KEGG: H00031
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Cleft lip	PMID: 18683894
Colitis	PMID: 19915572
Crohn's disease	PMID: 19398441
Endometriosis	PMID: 20410224
Female infertility	PMID: 24700054
Gastric cancer	KEGG: H00018
Glaucoma	PMID: 16276119
Hepatocellular carcinoma	KEGG: H00048
Hydrosalpinx	PMID: 20605145
Recurrent pregnancy loss(RPL)/ Abortion/ Miscarriage/ Recurrent pregnancy failure/Pregnancy loss/ Recurrent miscarriage/ Spontaneous abortion	PMID: 27793380
Nasopharyngeal cancer	KEGG: H00054
Oligozoospermia	PMID: 15033487
Ovarian endometriosis	PMID: 25150394
Ovarian endometriosis	PMID: 9647570
Ovarian endometriosis	PMID: 8841809
Ovarian endometriosis	PMID: 25150394
Ovarian endometriosis	PMID: 27023436
Penile cancer	KEGG: H00025
Ovarian endometriosis	INFBASE27023436
Endometriosis associated infertility	INFBASE20410224
Endometrial carcinoma	INFBASE18295959
Adenomyosis	INFBASE9392916
Endometriosis	INFBASE9392916
Ovarian endometriosis	INFBASE8841809
Thyroid cancer	KEGG: H00032
Amenorrhea	PMID: 25150394

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23899551	Endometrio sis			41 (15 endometr ium from patien ts, 26 endometr ium from contro ls)		HOXA10 ESR1 CDH1 CDKN1A HRH4 HIST2H3C	Show abstract
23639674	Endometrio sis			32 (13 endometr iosis lesions, 11 isolated end ometriotic-like cells (IELC)-p ositive pelvic sentinel lymph nodes (PSLN), 8 ELC-negative P SLN))		EPCAM CDH1 (E-cadherin) CXCR4 CD44	Show abstract
26484421	Endometrio sis	CDH1 (-160C/A polymorphism, +54C/T)	Iranian	300 (149 patien ts with endomet riosis (stages I-IV), 151 heal thy women as co ntrols)			Show abstract
20410224	Endometrio sis			258 (151 infert ile patients wi th endometriosi s, 41 uterine f ibromas, 9 pati ents with unexp lained infertil ity, 57 healthy fertile contro ls)	Female infertility	E-cadherin beta-catenin	Show abstract
18295959	Endometrio sis			40 (15 endometr iotic tissue, 1 5 low-grade end ometrial endome trioid carcinom as, 10 unremark able proliferat ive endometrium from women wit hout endometrio sis or carcinom a)		MMP-2 MMP-9 E-cadherin and beta-catenin	Show abstract
10871648	Endometrio sis			115 (36 patient s without endom etriosis, 79 p atients with, e ndometriosis)		EGF EGFR E-cadherin beta-catenin alpha- catenin	Show abstract
8841809	Endometrio sis (Ovari an)					CDH1 CTNNA1 CTNNB1	Show abstract
22434855	Endometrio sis	E-cadherin (rs4783689)	Japanes e	1009 (511 women with endometri osis (the major ity in Stages I II and IV), 498 healthy contro ls)		E-cadherin	Show abstract
22184339	Endometrio sis	E-cadherin (-347GA/GA, -160A/A, -347GA/-160A/+54C, -347G/-160A/+54C haplotypes)	Indian	1215 (715 endom etriosis cases, 500 controls)		E-cadherin	Show abstract
17660246	Endometrio sis	E-cadherin (3'-UTR C --> T polymorphism, -160 A/-347 GA haplotype)		341 (152 endome triosis patient s, 189 control women)		E-cadherin	Show abstract
12906167	Endometrio sis			62 (32 patients with endometri osis, 30 health y women)		E-cadherin	Show abstract
9392916	Endometrio sis			46 (24 patients with endometri osis, 22 patien ts with adenomy osis)		VLA-2 VLA-3 VLA-4 VLA-5 VLA-6 E-cadherin	Show abstract
28438065	Endometrio sis					TGFB1 Snail CDH1 VIM PCNA	Show abstract
26198055	Endometrio sis			121 (47 control s, 74 patients with endometrio sis)		CDH1 TWIST1 SNAIL SLUG MYC	Show abstract
27023436	Endometrio sis (ovari an)			100 (50 patient s with ovarian endometriosis ( stage III�IV), 50 controls (38 controls due to cervical int raepithelial ne oplasia III, 1 2 patients with cervical intra epithelial neop lasia III))			Show abstract